TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01278 XX ID T01278 XX DT 18.10.1994 (created); ewi. DT 23.02.2005 (updated); elf. CO Copyright (C), QIAGEN. XX FA HOXA7 XX SY homeo box A7; Hox-1.1; HOXA7; m6. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G014476 Hoxa7. XX HO Ubx (Drosophila). XX CL C0006; homeo. XX SZ 229 AA; 25.7 kDa (cDNA) (calc.). XX SQ MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGPGAGAFASTVPGLYNVNSP SQ LYQSPFASGYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYP SQ WMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNR SQ RMKWKKEHKDESQAPTAAPEDAVPSVSTAADKADEEEEEEEEEEEEEEE XX SC Swiss-Prot#P02830 XX FT 127 187 PS50071; HOMEOBOX_2. FT 129 191 SM00389; HOX_1. FT 130 186 PF00046; Homeobox domain. XX SF binds with relatively low affinity to homeo domain consensus sites (KD = 7 nM) [2]; XX FF ubiquitous expression of human HOXA7 in transgenic mice is lethal in causing craniofacial abnormalities [5]; FF expressed in fetal kidney cortex [7] [6]; XX MX M01108 V$HOXA7_01. MX M01336 V$HOXA7_02. MX M01394 V$HOXA7_03. XX BS R03849. XX DR TRANSPATH: MO000046041. DR EMBL: M17192; MMHOX1. DR EMBL: U15972; MM15972. DR UniProtKB: P02830; HXA7_MOUSE. XX RN [1]; RE0001728. RX PUBMED: 8264592. RA Gross M. K., Gruss P. RT Functional analysis of mouse Hoxa-7 in Saccharomyces cerevisiae: sequences outside the homeodomain base contact zone influence binding and activation RL Mol. Cell. Biol. 14:238-254 (1994). RN [2]; RE0003885. RX PUBMED: 7911971. RA Pellerin I., Schnabel C., Catron K. M., Abate C. RT Hox proteins have different affinities for a consensus DNA site that correlate with the positions of their genes on the hox cluster RL Mol. Cell. Biol. 14:4532-4545 (1994). RN [3]; RE0003887. RX PUBMED: 2885847. RA Kessel M., Schulze F., Fibi M., Gruss P. RT Primary structure and nuclear localization of a murine homeodomain protein RL Proc. Natl. Acad. Sci. USA 84:5306-5310 (1987). RN [4]; RE0003888. RX PUBMED: 2986010. RA Colberg-Poley A. M., Voss S. D., Chowdhury K., Gruss P. RT Structural analysis of murine genes containing homoeo box sequences and their expression in embryonal carcinoma cells RL Nature 314:713-718 (1985). RN [5]; RE0003894. RX PUBMED: 2568891. RA Balling R., Mutter G., Gruss P., Kessel M. RT Cranofacial abnormailities induced by ectopic expression of the homeobox gene HOX-1.1 in transgenic mice RL Cell 58:337-347 (1989). RN [6]; RE0006759. RX PUBMED: 7538068. RA Knittel T., Kessel M., Kim M. H., Gruss P. RT A conserved enhancer of the human and murine Hoxa-7 gene specifies the anterior boundary of expression during embryonal development RL Development 121:1077-1088 (1995). RN [7]; RE0014517. RA Davies J. A., Brandli A. W. RT The Kidney Development Database; URL: http://www.ana.ed.ac.uk/anatomy/database/kidbase/tranfack.html RL Internet : (1997). XX //