TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01476 XX ID T01476 XX DT 02.05.1995 (created); ewi. DT 07.02.2006 (updated); vma. CO Copyright (C), QIAGEN. XX FA Abd-B XX SY Abdominal-B. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX GE G021776 Abd-B. XX CL C0006; homeo. XX SZ 491 AA; 55.0 kDa (gene) (calc.). XX SQ MQQHHLQQQQQQQQQQEQQHLQEQQQHLQQLHHHAHHHLPQPLHTTSHHHSAHPHLQQQQ SQ QQQQHAVVASSPSVLQQQQQQSTPTTHSTPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQ SQ LQQQQQQQQQQLATTPVAGALSPAQTPTGPSAQQQQHLTSPHHQQLPQQQTPNSVPVRSS SQ NLQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGF SQ ETDTSAAVKRHTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQ SQ TTSAAAAAAYMNEADGHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASG SQ GLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELAR SQ NLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLNLSL SQ NMGHHAAKMHQ XX SC Swiss-Prot#P09087 XX FT 56 65 PF00904; Involucrin repeat. FT 63 339 PF00478; IMP dehydrogenase / GMP reductase domain. FT 383 443 PS50071; HOMEOBOX_2. FT 385 447 SM00389; HOX_1. FT 386 442 PF00046; Homeobox domain. XX SF prefers a TTAT core sequence to bind to instead of TAAT as most other homeo domain factors [1]; SF DNA-binding specificity is mainly determined by the N-terminal arm of the homeo domain [1]; XX FF activator in the eighth abdominal segment of early- and mid-stage embryos [3]; FF homeotic selector gene; FF required together with Ems, which it activates, to induce formation of filzkoerper primordia [3]; FF expression is repressed by Hunchback and Krueppel, which define the anterior border, and Knirps, which is responsible for the graded expression across to the expression zone [4]; FF region-specific silencing is mediated by three region of the Abd-B gene, requiring Hunchback and Polycomb [4]; FF specific control regions govern expression in the different parasegments [5]; XX MX M00090 I$ABDB_01. MX M02283 I$ABDB_02. MX M07754 I$ABDB_03. MX M07755 I$ABDB_04. MX M07756 I$ABDB_05. MX M07757 I$ABDB_06. MX M01094 I$ABDB_Q6. XX BS R09578. BS R17402. BS R17403. BS R17405. BS R17406. BS R17408. BS R17410. BS R17411. BS R02507. XX DR TRANSPATH: MO000025698. DR EMBL: M21173; DR EMBL: X16134; DR UniProtKB: P09087; DR FLYBASE: FBgn0000015; Abd-B. XX RN [1]; RE0002965. RX PUBMED: 7914870. RA Ekker S. C., Jackson D. G., von Kessler D. P., Sun B. I., Young K. E., Beachy P. A. RT The degree of variation in DNA sequence recognition among four Drosophila homeotic proteins RL EMBO J. 13:3551-3560 (1994). RN [2]; RE0004957. RX PUBMED: 2575066. RA Celniker S. E., Keelan D. J., Lewis E. B. RT The molecular genetics of the bithorax complex of Drosophilia: characterisation of the products of the Abd-B domain RL Genes Dev. 3:1424-1436 (1989). RN [3]; RE0004958. RX PUBMED: 8094700. RA Jones B., McGinnis W. RT The regulation of spiracles by Abdominal-B mediates an abdominal segment identity function RL Genes Dev. 7:229-240 (1993). RN [4]; RE0004959. RX PUBMED: 8096812. RA Busturia A., Bienz M. RT Silencers in Abdominal-B, a homeotic Drosophila gene RL EMBO J. 12:1415-1425 (1993). RN [5]; RE0004960. RX PUBMED: 7915032. RA Karch F., Galloni M., Sipos L., Gausz J., Gyurkovics H., Schedl P. RT MCP and Fab-7: molecular analysis of putative boundaries of cis-regulatory domains in the bithorax complex of Drosophila melanogaster RL Nucleic Acids Res. 22:3138-3146 (1994). RN [6]; RE0015328. RX PUBMED: 7902124. RA Kalionis B., O'Farrell P. H. RT A universal target sequence is bound in vitro by diverse homeodomains RL Mech. Dev. 43:57-70 (1993). XX //