TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01760 XX ID T01760 XX DT 17.04.1996 (created); ewi. DT 23.02.2005 (updated); elf. CO Copyright (C), QIAGEN. XX FA HOXD11 XX SY homeo box D11; Hox-4.6; Hox-5.4; Hox-5.5; HOX4F (human); Hoxd-11; HOXD11. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G014504 Hoxd11. XX HO Abd-B (Drosophila). XX CL C0006; homeo. XX SZ 323 AA; 33.5 kDa (cDNA) (calc.). XX SQ MYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLERAKW SQ PYRGGGGGGAGGGGGGGPGGGGGGSGGYAPYYAAAAAAAAAAAAAEEAAMQRDLLPPAGR SQ RPDVLFKAPEPVCGAPGPPHGPAAAASNFYSAVGRNGILPQGFDQFYEAAPGPPFAGPQP SQ QPAPAPPQPEGAADKGDPKPGAGGGGGSPCAKATPGPEPKGAAEGGGGEGEGPPGEAGAE SQ KSGGTVAPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQ SQ NRRMKEKKLNRDRLQYFTGNPLF XX SC Swiss-Prot#P23813 XX FT 249 309 PS50071; HOMEOBOX_2. FT 251 313 SM00389; HOX_1. FT 252 308 PF00046; Homeobox domain. XX FF expressed in posterior parts of the developing embryo [2]; FF expressed in the distal domains of developing limb [1]; FF part of the cranio-caudal sequential expression pattern of the HOX gene clusters [2]; FF required for development of radius and ulna as well as for normal kidney development (together with HoxA11) [4]; FF a bipartite control domain in the 3'-flanking region comprises a general enhancer and a restricting domain, the latter governing the proper expression pattern [3]; XX MX M01434 V$HOXD11_01. XX DR TRANSPATH: MO000046064. DR EMBL: X60761; MMHOX46E1. DR EMBL: X60762; MMHOX46E2. DR EMBL: X71422; MMHOXD11. DR UniProtKB: P23813; HXDB_MOUSE. XX RN [1]; RE0004062. RX PUBMED: 2574828. RA Dolle P., Izpisua-Belmonte J.-C., Falkenstein H., Renucci A., Duboule D. RT Coordinate expression of the murine Hox-5 complex homoeobox-containing genes during limb pattern formation RL Nature 342:767-772 (1989). RN [2]; RE0004073. RX PUBMED: 1676674. RA Izpisua-Belmonte J.-C., Falkenstein H., Dolle P., Renucci A., Duboule D. RT Murine genes related to the Drosophila AbdB homeotic gene are sequentially expressed during development of the posterior part of the body RL EMBO J. 10:2279-2289 (1991). RN [3]; RE0004074. RX PUBMED: 7902810. RA Gerard M., Duboule D., Zakany J. RT Structure and activity of regulatory elements involved in the activation of Hoxd-11 gene during late gastrulation RL EMBO J. 12:3539-3550 (1993). RN [4]; RE0006760. RX PUBMED: 7596412. RA Davis A. P., Witte D. P., Hsieh-Li H. M., Potter S. S., Capecchi M. R. RT Absence of radius and ulna in mice lacking hoxa-11 and hoxd-11 RL Nature 375:791-795 (1995). XX //