TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01888 XX ID T01888 XX DT 09.08.1996 (created); ewi. DT 19.11.2007 (updated); pch. CO Copyright (C), QIAGEN. XX FA POU6F1 (c2) XX SY Brain-5 (c2); Brn-5 (c2); Emb (c2). XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002475 Pou6f1. XX CL C0007; POU. XX SZ 301 AA; 32.8 kDa (calc.), 32.9 kDa (m) XX SQ MPGISSQILTNAQGQVIGALPWVVNSASVATPAPAQSLQVQAVTPQLLLNAQGQVIATLA SQ SSPLPQPVAVRKPNTPESPAKSEVQPIQPTQAVPQPAVILTSPTPALKPSAATPIPITCS SQ ETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAY SQ SQSAICRFEKLDITPKSAQKLKPVLEKWLMEAELRNQEGQQNLMEFVGGEPSKKRKRRTS SQ FTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQI SQ P XX SC translated from EMBL #D13801 XX FT 139 213 PF00157; Pou domain - N-terminal to homeobox domain. FT 139 213 SM00352; pou. FT 232 292 PS50071; HOMEOBOX_2. FT 232 294 PS50550; POU_HOMEODOMAIN. FT 234 296 SM00389; HOX_1. FT 235 291 PF00046; Homeobox domain. XX SF at least four additional alternative splice products: POU6F1 c1, c5, c6, and c7, the last being a testis-specific variant in which a distinct 5'-UTR and thus another translation initiation region has been fused directly to the POU domain [4]; SF splice variants c3 and c4 differ from c2 only in the 5' UTR region and thus encode identical proteins [1]; SF binding consensus is very similar to Brn-3 proteins (POU4 group) [3]; XX CP (E15.5-16.5:) laminar region of forebrain cortex, mitral region of olfactory bulb, (adult:) brain, mitral cell layer of olfactory bulb, pyramidal cell layer of hippocampus, granule cell layer of cerebellum and cortex, kidney, skeletal muscle [1] [2]. CN (adult:) gut heart, liver [1]. XX FF may play a role in specifying a subset of neurons [2]; XX MX M00465 V$POU6F1_01. MX M01462 V$POU6F1_02. MX M01479 V$POU6F1_03. XX BS R10715. BS R10716. BS R10717. BS R10718. BS R10719. BS R10720. BS R10721. BS R10722. BS R10723. BS R10724. BS R10725. BS R10726. BS R10727. BS R10728. BS R10729. BS R10730. XX DR TRANSPATH: MO000026005. DR EMBL: D13801; DR UniProtKB: Q07916-1; XX RN [1]; RE0004419. RX PUBMED: 8463278. RA Okamoto K., Wakamiya M., Noji S., Koyama E., Taniguchi S., Takemura R., Copeland N. G., Gilbert D. J., Jenkins N. A., Muramatsu M., Hamada H. RT A novel class of murine POU gene predominantly expressed in central nervous system RL J. Biol. Chem. 268:7449-7457 (1993). RN [2]; RE0008988. RX PUBMED: 7908264. RA Wey E., Lyons G. E., Schaefer B. W. RT A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues RL Eur. J. Biochem. 220:753-762 (1994). RN [3]; RE0016787. RX PUBMED: 9852081. RA Rhee J. M., Gruber C. A., Brodie T. B., Trieu M., Turner E. E. RT Highly cooperative homodimerization is a conserved property of neural POU proteins RL J. Biol. Chem. 273:34196-34205 (1998). RN [4]; RE0000312. RX PUBMED: 3023048. RA Moncollin V., Miyamoto N. G., Zheng X. M., Egly J. M. RT Identification of a factor specific for the upstream element of the adenovirus-2 major late promoter RL EMBO J. 5:2577-2584 (1986). XX //