TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02046 XX ID T02046 XX DT 27.01.1997 (created); ewi. DT 09.05.2008 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Gsc XX SY goosecoid. XX OS chick, Gallus gallus OC eukaryota; animalia; metazoa; chordata; vertebrata; aves; neornithes; neognathae; galliformes; phasianidae XX GE G002112 Gsc. XX CL C0006; homeo. XX SZ 245 AA; 27.3 kDa (cDNA) (calc.). XX SQ MPASMFSIDNILAARPRCKDSVLLPPSAPVVFPSLHGDSLYGAASDYGGFYSRAVAPGSA SQ LPAVGRSRLGYNNYYYGQLHVATSPVGPSCCGAVPPLGAQQCSCVPPAGYEGAGSVLMSP SQ VPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTR SQ EQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAQKWNKASKTSPEKRQEDGKSD SQ LDSDS XX SC translated from EMBL #X70471 XX FT 148 208 PS50071; HOMEOBOX_2. FT 150 206 PS50552; PAX. FT 150 212 SM00389; HOX_1. FT 151 207 PF00046; Homeobox domain. XX FF involved in the embryonic organization of the body axis by mediating the effects of the corresponding organizer [1]; FF Gsc positive parts of the primitive streak induces neurulation while cells expressing Gsx T04040 induces gastrulation [2]; XX DR TRANSPATH: MO000026117. DR EMBL: X70471; DR UniProtKB: P53545; XX RN [1]; RE0005101. RX PUBMED: 7916659. RA Izpisua-Belmonte J. C., de Robertis E. M., Storey K. G., Stern C. D. RT The homeobox gene goosecoid and the origin of organizer cells in the early chick embryo RL Cell 74:645-659 (1993). RN [2]; RE0015379. RX PUBMED: 9108361. RA Lemaire L., Roeser T., Izpisua-Belmonte J. C., Kessel M. RT Segregating expression domains of two goosecoid genes during the transition from gastrulation to neurulation in chick embryos RL Development 124:1443-1452 (1997). XX //