TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02256 XX ID T02256 XX DT 06.11.1997 (created); ili. DT 13.04.2007 (updated); smt. CO Copyright (C), QIAGEN. XX FA AML1a XX SY AML1; CBF-alpha 2; CBFA2; PEBP2alphaB; RUNX1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003993 RUNX1; HGNC: RUNX1. XX CL C0029; runt; 6.4.1.0.2.1. XX SZ 472 AA; 50.7 kDa (cDNA) (calc.). XX SQ MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPG SQ ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA SQ TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR SQ QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM SQ QDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDL SQ TAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPG SQ SSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP SQ NQSDVVEAEGSHSNSPTNMGGASCSRQARRDPGPWARTPSWGRGRPTDRISL XX SC Swiss-Prot#Q01196-2 XX FT 48 182 PF00853; Runt domain. FT 50 178 PS51062; RUNT. XX SF product of AML1 gene as the result of differential usage of polyadenylation signals [3]; SF related products are AML1b and AML1c [3]; SF AML1a is a minor product [3]; SF this isoform is not associated with the nuclear matrix [5]; XX CN brain [3], heart [3] [3]. XX FF RUNX1a (AML1a) is the inactive form of RUNX [6]; FF related to t(8,21) acute myeloid leukemia; FF may act as a negative regulator [3]; FF specific negative regulator for transactivation by AML1b [4]; FF bind to the PEBP2 site with higher affinity than AML1b [4]; FF change the response of 32Dcl3 murine myeloid cells to granulocyte colony-stimulating factor from terminal granulocytic differentiation to exponential cell proliferation, effect antagonized by AML1b [4]; FF transcripts are more abundant in bone marrow cells of more than half of myelogenous leukemia patients [4]; XX MX M00271 V$AML1_01. MX M01658 V$AML1_Q4. MX M07242 V$AML1_Q4_01. MX M08865 V$AML1_Q4_02. MX M02084 V$AML1_Q5. MX M08866 V$AML_Q4. MX M00769 V$AML_Q6. MX M00984 V$PEBP_Q6. XX BS R04667. BS R04442. BS R07884. BS R07885. BS R07886. BS R07887. BS R07888. BS R07889. BS R07890. BS R07891. BS R07892. BS R07893. BS R07894. BS R07895. BS R07896. BS R07897. BS R07898. BS R07899. BS R07900. BS R07901. BS R07902. BS R07903. BS R07904. BS R07905. BS R07906. BS R07907. BS R07908. BS R07909. BS R07910. BS R07911. BS R07912. BS R07913. BS R07914. BS R07915. BS R07916. BS R07917. BS R07918. BS R07919. BS R07920. BS R07921. BS R07922. BS R07923. BS R07924. BS R07925. BS R07926. BS R07927. BS R07928. BS R07929. BS R07930. BS R07931. BS R07932. BS R07933. BS R07934. BS R07935. BS R07936. BS R07937. BS R07938. BS R07939. BS R07940. BS R20998. BS R05026. BS R05028. XX DR TRANSPATH: MO000026263. DR EMBL: D10570; DR UniProtKB: Q01196-2; XX RN [1]; RE0002540. RX PUBMED: 8341710. RA Ogawa E., Maruyama M., Kagoshima H., Inuzuka M., Lu J., Satake M., Shigesada K., Ito Y. RT PEBP2/PEA2 represents a family of transcription factors homologous to the products of the Drosophila runt gene and the human AML1 gene RL Proc. Natl. Acad. Sci. USA 90:6859-6863 (1993). RN [2]; RE0006067. RX PUBMED: 8413232. RA Meyers S., Downing J. R., Hiebert S. W. RT Identification of AML-1 and the (8;21) translocation protein (AML-1/ETO) as sequence-specific DNA-binding proteins:the runt homology domain is required for DNA binding and protein-protein interactions RL Mol. Cell. Biol. 13:6336-6345 (1993). RN [3]; RE0006068. RX PUBMED: 7651838. RA Miyoshi H., Ohira M., Shimizu K., Mitani K., Hirai H., Imai T., Yokoyama K., Soeda E., Ohki M. RT Alternative splicing and genomic structure of the AML1 gene involved in acute myeloid leukemia RL Nucleic Acids Res. 23:2762-2769 (1995). RN [4]; RE0006069. RX PUBMED: 7530657. RA Tanaka T., Tanaka K., Ogawa S., Kurokawa M., Mitani K., Nishida J., Shibata Y., Yazaki Y., Hirai H. RT An acute myleoid leukemia gene, AML1, regulates hemopoietic myeloid cell differentiation and transcriptional activation antagonistically by two alternative spliced forms RL EMBO J. 14:341-350 (1995). RN [5]; RE0006488. RX PUBMED: 9192636. RA Zeng C., van Wijnen A. J., Stein J. L., Meyers S., Sun W., Shopland L., Lawrence J. B., Penman S., Lian J.B., Stein G. S., Hiebert S. W. RT Identification of a nuclear matrix targeting signal in leukemia and bone-related AML/CBF-alpha transcription factors RL Proc. Natl. Acad. Sci. USA 94:6746-6751 (1997). RN [6]; RE0035612. RX PUBMED: 16338472. RA Schaubach B. M., Wen H. Y., Kellems R. E. RT Regulation of Murine Ada Gene Expression in the Placenta by Transcription Factor RUNX1. RL Placenta 27:269-277 (2006). XX //