TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02378 XX ID T02378 XX DT 03.04.1998 (created); ewi. DT 27.04.2009 (updated); djp. CO Copyright (C), QIAGEN. XX FA usf1 XX SY B1 Factor; eUSF (duck); MLTF; pf51; UEF; upstream stimulatory factor; USF; USF1. XX OS Kenyan clawed frog, Xenopus borealis OC eukaryota; animalia; metazoa; chordata; vertebrata; amphibia; lissamphibia; anura; archeobatrachia; pipoidea; pipidae XX CL C0012; bHLH-ZIP. XX SZ 307 AA; 33.6 kDa (cDNA) (calc.). XX SQ MKGQQKVADIEEGTVRVQEEGAVATGEDPTSVAIASIQSAATFSDPNVKYVFRTENGGAQ SQ VMYRVIQVAEGQLDGQTEGTGAISGFPATQSMTQAVIQGAFTSDDNGETDASGPETHYTY SQ FPTDSSTSVGGTPTTVVTTHNSDTLLGQAASTGTGQFYVMMSSQDVLQGGSQRSIAPRTH SQ PYSPKSDGPRTTRDDKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKTGQSKGGI SQ LSKACDYIQELRQSNLRLSEELQNLDQLQMDNEVLRQQVEDLKNNNLTLRTQLRHHGVEI SQ IIKSDTH XX SC Swiss-Prot#Q07957 XX FT 195 252 PS50888; HLH. FT 197 252 PF00010; Helix-loop-helix DNA-binding domain. FT 202 257 SM00353; finulus. XX IN T01555 USF2; mouse, Mus musculus. XX MX M01034 V$EBOX_Q6_01. MX M07067 V$USF1_Q4. MX M00121 V$USF_01. MX M00122 V$USF_02. MX M00217 V$USF_C. MX M00187 V$USF_Q6. MX M00796 V$USF_Q6_01. XX BS R02090. BS R00853. BS R03005. BS R01768. BS R02259. XX DR TRANSPATH: MO000026368. DR EMBL: M63663; DR UniProtKB: Q07957; XX RN [1]; RE0000468. RX PUBMED: 2323340. RA Workman J. L., Roeder R. G., Kingston R. E. RT An upstream transcription factor, USF (MLTF), facilitates the formation of preinitiation complexes during in vitro chromatin assembly RL EMBO J. 9:1299-1308 (1990). RN [2]; RE0000697. RX PUBMED: 2249772. RA Gregor P. D., Sawadogo M., Roeder R. G. RT The adenovirus major late transcription factor USF is a member of the helix-loop-helix group of regulatory proteins and binds to DNA as a dimer RL Genes Dev. 4:1730-1740 (1990). RN [3]; RE0001500. RX PUBMED: 1986236. RA Kaulen H., Pognonec P., Roeder R. G., Gregor P. D. RT The xenopus B1 factor is closely related to the mammalian activator USF and is implicated in the developmental regulation of TFIIIA gene expression RL Mol. Cell. Biol. 11:412-424 (1991). RN [4]; RE0002071. RX PUBMED: 2204028. RA Moncollin V., Stalder R., Verdier J.-M., Sentenac A., Egly J.-M. RT A yeast homolog of the human UEF stimulates transcription from the adenovirus 2 major late promoter in yeast and in mammalian cell-free systems RL Nucleic Acids Res. 18:4817-4823 (1990). RN [5]; RE0002103. RX PUBMED: 2831501. RA Watt F., Molloy P. L. RT High mobility group proteins 1 and 2 stimulate binding of a specific transcription factor to the adenovirus major late promoter RL Nucleic Acids Res. 16:1471-1486 (1988). RN [6]; RE0002277. RX PUBMED: 2951737. RA Kovesdi I., Reichel R., Nevins J. R. RT Role of an adenovirus E2 promoter binding factor in E1A-mediated coordinate gene control RL Proc. Natl. Acad. Sci. USA 84:2180-2184 (1987). RN [7]; RE0006752. RX PUBMED: 8938446. RA Aperlo C., Boulukos K. E., Sage J., Cuzin F., Pognonec P. RT Complete sequencing of the murine USF gene and comparison of its genomic organization to that of mFIP/USF2 RL Genomics 37:337-344 (1996). XX //