TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02755 XX ID T02755 XX DT 04.06.1999 (created); mpr. DT 29.03.2006 (updated); ili. CO Copyright (C), QIAGEN. XX FA CAR2 XX SY CAR-beta; constitutive androstane receptor; MB67; NR1I3; NR1I4; phenobarbital receptor. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004778 Nr1i3. XX CL C0002; CC (rec). XX SZ 286 AA; 32.5 kDa (cDNA) (calc.). XX SQ MTAMLTLETMASEEEYGPRNCVVCGDRATGYHFHALTCEGCKGFFRRTVSKTIGPICPFA SQ GRCEVSKAQRRHCPACRLQKCLNVGMRKDMILSAEALALRRARQAQRRAEKASLQLNQQQ SQ KELVQILLGAHTRHVGPLFDQFVQFKPPAYLFMHHRPFQPRGPVLPLLTHFADINTFMVQ SQ QIIKFTKDLPLFRSLTMEDQISLLKGAAVEILHISLNTTFCLQTENFFCGPLCYKMEDAV SQ HAGFQYEFLESILHFHKNLKGLHLQEPEYVLMAATALFSPGFCMQS XX SC translated from EMBL #AF009328 XX FT 18 89 SM00399; c4gold. FT 18 93 PS51030; NUCLEAR_REC_DBD_2. FT 19 94 PF00105; Zinc finger, C4 type (two domains). XX SF short isoform, for the long isoform see T05687 [2]; SF is missing C-terminal part of the LBD/dimerization domain, both AF-2 and I box motifs are absent [2]; XX CP liver [2]. XX FF does not bind to DNA or interfere with transactivation by CAR1 [2]; XX MX M07280 V$NR1NR2_Q3. XX DR TRANSPATH: MO000026729. DR EMBL: AF009328; DR UniProtKB: O35627-2; XX RN [1]; RE0013625. RX PUBMED: 10219237. RA Nuclear Receptors Nomenclature Committee. RT A unified nomenclature system for the nuclear receptor superfamily RL Cell 97:161-163 (1999). RN [2]; RE0013646. RX PUBMED: 9295294. RA Choi H. S., Chung M., Tzameli I., Simha D., Lee Y. K., Seol W., Moore D. D. RT Differential transactivation by two isoforms of the orphan nuclear hormone receptor CAR RL J. Biol. Chem. 272:23565-23571 (1997). XX //