TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T03257 XX ID T03257 XX DT 26.04.2000 (created); rio. DT 24.02.2012 (updated); grs. CO Copyright (C), QIAGEN. XX FA HNF-6alpha XX SY HNF-6; HNF-6A. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004831 Onecut1. XX HO Cut (Drosophila). XX CL C0006; homeo. XX SZ 465 AA; 51.1 kDa (cDNA) (calc.), 53-55 kDa (SDS) [1] XX SQ MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVGHRGSHLPPAHPRSMGMASLLD SQ GGSGGSDYHHHHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSD SQ KFPHHHHHHHHHHHPHHHQRLAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLS SQ PLSGSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNDFEAHHPAMLGRHGEQHLTPTSAG SQ MVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEINTKEVAQR SQ ITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQ SQ RMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQ SQ QLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA XX SC Swiss-Prot#P70512-1 XX FT 283 369 PF02376; CUT domain. FT 283 369 PS51042; CUT. FT 383 443 PS50071; HOMEOBOX_2. FT 384 444 PS50560; CUT_HOMEODOMAIN. FT 385 447 SM00389; HOX_1. FT 386 442 PF00046; Homeobox domain. XX SF Both homeodomain and cut domain of this protein are required for its binding to the sites R20374, and R20376 in the enhancer III of rat AFP gene G000691 [5]; SF ONECUT class of homeodomain proteins [2]; SF the two isoforms differ by the linker that separates cut and homeo domain, the affinity of both isoforms for DNA is different depending on the target sequence, both isoforms are binding as monomers whereas cut and/or homeo domain can be involved in binding [2]; XX CP (adult:) liver, brain, testis, spleen [1]. CN (adult:) lung, kidney, adipose tissue, heart, muscle, small intestine, thymus [1]. XX FF transcriptional activator [1] [3]; FF involved in regulation of liver and intestinal gene expression [2] [3]; XX IN T15118 CBP; Mammalia. IN T06298 p53; monkey, Cercopithecus aethiops. XX MX M03829 V$HNF6_Q4. MX M00639 V$HNF6_Q6. MX M07357 V$HNF6_Q6_01. XX BS R13047. BS R08921. BS R08910. BS R08923. BS R01464. BS R08922. BS R08916. BS R20374. BS R20376. BS R08915. BS R08924. BS R08911. BS R08912. BS R02988. BS R08914. BS R08917. BS R08894. XX DR TRANSPATH: MO000027195. DR TRANSCOMPEL: C00543. DR EMBL: X96553; DR UniProtKB: P70512-1; XX RN [1]; RE0013188. RX PUBMED: 8790352. RA Lemaigre F. P., Durviaux S. M., Truong O., Lannoy V. J., Hsuan J. J., Rousseau G. G. RT Hepatocyte nuclear factor 6, a transcription factor that contains a novel type of homeodomain and a single cut domain RL Proc. Natl. Acad. Sci. USA 93:9460-9464 (1996). RN [2]; RE0014432. RX PUBMED: 9593691. RA Lannoy V. J., Burglin T. R., Rousseau G. G., Lemaigre F. P. RT Isoforms of hepatocyte nuclear factor-6 differ in DNA-binding properties, contain a bifunctional homeodomain, and define the new ONECUT class of homeodomain proteins RL J. Biol. Chem. 273:13552-13562 (1998). RN [3]; RE0014471. RX PUBMED: 8887657. RA Samadani U., Costa R. H. RT The transcriptional activator hepatocyte nuclear factor 6 regulates liver gene expression RL Mol. Cell. Biol. 16:6273-6284 (1996). RN [4]; RE0042447. RX PUBMED: 10811635. RA Lannoy V. J., Rodolosse A., Pierreux C. E., Rousseau G. G., Lemaigre F. P. RT Transcriptional stimulation by hepatocyte nuclear factor-6. Target-specific recruitment of either CREB-binding protein (CBP) or p300/CBP-associated factor (p/CAF) RL J. Biol. Chem. 275:22098-103 (2000). RN [5]; RE0049044. RX PUBMED: 12379144. RA Nacer-Cherif H., Bois-Joyeux B., Rousseau G. G., Lemaigre F. P., Danan J. L. RT Hepatocyte nuclear factor-6 stimulates transcription of the alpha-fetoprotein gene and synergizes with the retinoic-acid-receptor-related orphan receptor alpha-4. RL Biochem. J. 369:583-591 (2003). RN [6]; RE0068251. RX PUBMED: 16895524. RA Maeda Y., Hwang-Verslues W. W., Wei G., Fukazawa T., Durbin M. L., Owen L. B., Liu X., Sladek F. M. RT Tumour suppressor p53 down-regulates the expression of the human hepatocyte nuclear factor 4alpha (HNF4alpha) gene. RL Biochem. J. 400:303-313 (2006). XX //