TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T03929 XX ID T03929 XX DT 12.10.2000 (created); rio. DT 16.11.2007 (updated); jag. CO Copyright (C), QIAGEN. XX FA Barx-2 XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G001922 Barx2. XX HO BarH1T03926, BarH2T03927 (Drosophila). XX CL C0006; homeo. XX SZ 228 AA; 25.2 kDa (cDNA) (calc.), 66 kDa (SDS) [1] XX SQ MIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAYPLPSVITRQPTVISH SQ LVPTGSGLTPVLTRHPVAAAEAAAAAAETPGGEALASSESETEQPTPRQKKPRRSRTIFT SQ ELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPT SQ KPKGRPKKNSIPTSEEIEAEEKMNSQAQSQELLESSEREASSEPPPLS XX SC translated from EMBL #L77900 XX FT 108 114 basic hexapeptide, resembles nuclear localization signal [1]. FT 110 170 PS50071; HOMEOBOX_2. FT 112 174 SM00389; HOX_1. FT 113 169 PF00046; Homeobox domain. FT 179 194 basic domain [1]. FT 195 201 acidic domain [1]. XX SF 87% identity to murine Barx1 T02403 homeo domain [1]; SF expression pattern overlaps with Barx1 T02403, for detailed expression pattern see [1]; SF the 17-amino acid Barx Basic Region(BBR) is required for Barx-2 binding to the homeodomain binding sites of L1, Ng-CAM, and N-CAM [2]; SF interacts with factors CREB1 and ATF-2 [2]; XX EX Rathke's pouch,,,Theiler Stage 19; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX dorsal root ganglion,,,Theiler Stage 17; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX ectodermal infoldings of the eye,,,Theiler Stage 17; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX first pharyngeal pouch,,,Theiler Stage 17; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX floor plate of diencephalon,,,Theiler Stage 19; high; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX forelimb bud,,,Theiler Stage 17; low; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX forelimb bud,,,Theiler Stage 19; low; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX forelimb bud,mesenchyme cell,,Theiler Stage 19; low; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX frontonasal process,,,Theiler Stage 19; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX future mesencephalon,,,Theiler Stage 15; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX hindlimb bud,,,Theiler Stage 17; low; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX mantle layer of mesencephalon,,,Theiler Stage 19; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX mantle layer of telencephalon,,,Theiler Stage 19; medium; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX precartilaginous condensations of the forelimb,,,Theiler Stage 17; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX rhombencephalon,,,Theiler Stage 19; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX rhombencephalon,,,Theiler Stage 20; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX spinal cord,,,Theiler Stage 17; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX telencephalon,,,Theiler Stage 15; high; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX telencephalon,,,Theiler Stage 19; low; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX telencephalon,,,Theiler Stage 20; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. XX FF can act as repressor and activator [1] [2]; FF activation of CAM L1 (cell adhesion molecule) gene expression [1]; XX MX M01431 V$BARX2_01. XX BS R09450. BS R16312. BS R01678. BS R01679. XX DR TRANSPATH: MO000027839. DR EMBL: L77900; DR UniProtKB: O08686; XX RN [1]; RE0015165. RX PUBMED: 9122247. RA Jones F. S., Kioussi C., Copertino D. W., Kallunki P., Holst B. D., Edelman G. M. RT Barx2, a new homeobox gene of the Bar class, is expressed in neural and craniofacial structures during development RL Proc. Natl. Acad. Sci. USA 94:2632-2637 (1997). RN [2]; RE0025138. RX PUBMED: 10781615. RA Edelman D. B., Meech R., Jones F. S. RT The homeodomain protein Barx2 contains activator and repressor domains and interacts with members of the CREB family. RL J. Biol. Chem. 275:21737-21745 (2000). XX //