TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04293 XX ID T04293 XX DT 05.02.2001 (created); rio. DT 14.04.2009 (updated); ach. CO Copyright (C), QIAGEN. XX FA lmx1b-isoform1 XX SY LIM homeobox transcription factor 1, beta; LMX1.2; LMX1B; NPS1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002228 LMX1B; HGNC: LMX1B. XX CL C0025; LIM-homeo; 3.1.5.6.2.1. XX SZ 379 AA; 42.4 kDa (cDNA) (calc.). XX SQ MLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQC SQ AACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCC SQ CVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQG SQ SQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVV SQ QVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQEVLSSRMEGMMASYTPLAPPQQQIVAME SQ QSPYGSSDPFQQGLTPPQMPGDHMNPYGNDSIFHDIDSDTSLTSLSDCFLGSSDVGSLQA SQ RVGNPIDRLYSMQSSYFAS XX SC translated from EMBL #AF057135 XX FT 31 90 PS50023; LIM_DOMAIN_2. FT 32 83 SM00132; lim_4. FT 33 89 PF00412; LIM domain. FT 91 145 SM00132; lim_4. FT 91 152 PS50023; LIM_DOMAIN_2. FT 92 151 PF00412; LIM domain. FT 194 254 PS50071; HOMEOBOX_2. FT 196 258 SM00389; HOX_1. FT 197 253 PF00046; Homeobox domain. FT 197 253 PS50558; LIM_HOMEODOMAIN. XX SF mutation/haploinsufficiency causes nail-patella syndrome (NPS) involving maldevelopment of the fingernails, kneecaps and elbow joints, hip dislocation, club foot, renal disease and open-angle glaucoma (OAG) [2] [3] [5]; SF expression in substantia nigra is reduced in Parkinson patients due to the loss of dopaminergic neurons in this region [6]; XX EX brain,,,adult; low; RT-PCR; total RNA; [1]. EX duodenum,,,adult; high; RT-PCR; total RNA; [1]. EX fatty layer of subcutaneous tissue,,,adult; low; RT-PCR; total RNA; [1]. EX fatty layer of subcutaneous tissue,dopaminergic cell in compact part of substantia nigra,,adult; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [6]. EX liver,,,adult; none; RT-PCR; total RNA; [1]. EX lung (right and left),,,adult; very low; RT-PCR; total RNA; [1]. EX muscles,,,adult; high; RT-PCR; total RNA; [1]. EX pancreas,,,adult; none; RT-PCR; total RNA; [1]. EX pancreatic islets,,,adult; high; RT-PCR; total RNA; [1]. EX spleen,,,adult; very low; RT-PCR; total RNA; [1]. EX testis (right and left),,,adult; very high; RT-PCR; total RNA; [1]. EX thyroid gland,,,adult; high; RT-PCR; total RNA; [1]. XX FF involved in dorsoventral patterning during limb development [2]; FF transcriptional activator, transactivation is downregulated by CLIM2 T04197 [4]; FF may be involved in genesis and differentiation of the mesencephalic dopaminergic system [6]; XX MX M01363 V$LMX1B_01. XX DR TRANSPATH: MO000028155. DR EMBL: AF057135; DR UniProtKB: O60663-1; XX RN [1]; RE0015716. RX PUBMED: 9441763. RA Iannotti C. A., Inoue H., Bernal E., Aoki M., Liu L., Donis-Keller H., German M. S., Permutt M. A. RT Identification of a human LMX1 (LMX1.1)-related gene, LMX1.2: tissue-specific expression and linkage mapping on chromosome 9 RL Genomics 46:520-524 (1997). RN [2]; RE0015724. RX PUBMED: 9618165. RA Vollrath D., Jaramillo-Babb V. L., Clough M. V., McIntosh I., Scott K. M., Lichter P. R., Richards J. E. RT Loss-of-function mutations in the LIM-homeodomain gene, LMX1B, in nail-patella syndrome RL Hum. Mol. Genet. 7:1091-1098 (1998). RN [3]; RE0015725. RX PUBMED: 9837817. RA McIntosh I., Dreyer S. D., Clough M. V., Dunston J. A., Eyaid W., Roig C. M., Montgomery T., Ala-Mello S., Kaitila I., Winterpacht A., Zabel B., Frydman M., Cole W. G., Francomano C. A., Lee B. RT Mutation analysis of LMX1B gene in nail-patella syndrome patients RL Am. J. Hum. Genet. 63:1651-1658 (1998). RN [4]; RE0015731. RX PUBMED: 10767331. RA Dreyer S. D., Morello R., German M. S., Zabel B., Winterpacht A., Lunstrum G. P., Horton W. A., Oberg K. C., Lee B. RT LMX1B transactivation and expression in nail-patella syndrome RL Hum. Mol. Genet. 9:1067-1074 (2000). RN [5]; RE0015732. RX PUBMED: 10966502. RA Knoers N. V., Bongers E. M., Beersum S. E., Lommen E. J., Bokhoven H. V., Hol F. A. RT Nail-patella syndrome: identification of mutations in the LMX1B gene in dutch families RL J. Am. Soc. Nephrol. 11:1762-1766 (2000). RN [6]; RE0015733. RX PUBMED: 10725922. RA Smidt M. P., Asbreuk C. H., Cox J. J., Chen H., Johnson R. L., Burbach J. P. RT A second independent pathway for development of mesencephalic dopaminergic neurons requires Lmx1b RL Nat. Neurosci. 3:337-341 (2000). RN [7]; RE0015748. RX PUBMED: 8136842. RA Church D. M., Stotler C. J., Rutter J. L., Murrell J. R., Trofatter J. A., Buckler A. J. RT Isolation of genes from complex sources of mammalian genomic DNA using exon amplification RL Nat. Genet. 6:98-105 (1994). XX //