TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04610 XX ID T04610 XX DT 18.07.2001 (created); mas. DT 10.07.2014 (updated); pro. CO Copyright (C), QIAGEN. XX FA SXR XX SY NR1I2; PXR; steroid and xenobiotic receptor. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002750 NR1I2; HGNC: NR1I2. XX CL C0002; CC (rec). XX SZ 434 AA; 49.9 kDa (cDNA) (calc.). XX SQ LEVRPKESWNHADFVHVEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG SQ CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE SQ RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS SQ GCELPEPLQAPSREEAAKWSQVRKDLCSLKVSLQAAGGGWQCLELQTPSRQWRKEIFSLL SQ PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE SQ CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR SQ VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF SQ ATPLMQELFGITGS XX SC sequence taken from reference [1]: Blumberg et al., Genes Dev. 12, pp. 3195-3205 (1998) XX FT 2 352 PF00478; IMP dehydrogenase / GMP reductase domai. FT 38 110 SM00399; c4gold. FT 38 114 PS51030; NUCLEAR_REC_DBD_2. FT 39 115 PF00105; Zinc finger, C4 type (two domains). FT 41 107 DNA-binding domain [1]. FT 141 434 ligand-binding domain [1]. FT 245 404 SM00430; holi. FT 248 428 PF00104; Ligand-binding domain of nuclear hormon. XX SF sequence very similar to human PXR T04617 (EMBL #AF061056) except of exchanges at pos. 1 (L instead of M) and pos. 215-233 (AAGGGWQCLELQTPSRQWR instead of LRGEDGSVWNYKPPADSGG) [1]; SF N-terminal amino acid is Leucine that has strikingly shown to function as translational initiator [1]; XX CP (adult:) high levels in liver, moderate levels in small intestine [1]. EX adrenal cortex,,,adult; none; Northern blot; RNA (undefined); [1]. EX adrenal medulla,,,adult; none; Northern blot; RNA (undefined); [1]. EX brain,,,adult; none; Northern blot; RNA (undefined); [1]. EX heart,,,adult; none; Northern blot; RNA (undefined); [1]. EX kidney (right and left),,,adult; none; Northern blot; RNA (undefined); [1]. EX liver,,,adult; high; Northern blot; RNA (undefined); [1]. EX lung (right and left),,,adult; none; Northern blot; RNA (undefined); [1]. EX muscles,,,adult; none; Northern blot; RNA (undefined); [1]. EX pancreas,,,adult; none; Northern blot; RNA (undefined); [1]. EX placenta,,,adult; none; Northern blot; RNA (undefined); [1]. EX small intestine,,,adult; medium; Northern blot; RNA (undefined); [1]. EX stomach,,,adult; none; Northern blot; RNA (undefined); [1]. EX testis (right and left),,,adult; none; Northern blot; RNA (undefined); [1]. EX thymus,,,adult; none; Northern blot; RNA (undefined); [1]. EX thyroid gland,,,adult; none; Northern blot; RNA (undefined); [1]. XX FF ligands: binds many steroid like corticosterone (very potent ligand), pregnenolone, dihydrotestosterone, estradiol, cortisone, cortisol (synergistic activation) [1]; FF also activated by products of steroid catabolism (5alpha-tetrahydroxycorticosterone, 5beta-tetrahydroxycorticosterone) [1]; FF involved in detoxification of cholestatic bile acids in response to lithocholic acid (LCA) probably through transcriptional induction of CYP3A enzymes [2]; XX MX M00966 V$DR3_Q4. MX M00965 V$DR4_Q2. MX M07280 V$NR1NR2_Q3. MX M00964 V$PXR_Q2. XX BS R10082. BS R10083. BS R10084. BS R10085. BS R62795. BS R09957. XX DR TRANSPATH: MO000028443. DR UniProtKB: O75469; XX RN [1]; RE0016451. RX PUBMED: 9784494. RA Blumberg B., Sabbagh W J. r., Juguilon H., Bolado J J. r., van Meter C. M., Ong E. S., Evans R. M. RT SXR, a novel steroid and xenobiotic-sensing nuclear receptor RL Genes Dev. 12:3195-3205 (1998). RN [2]; RE0016456. RX PUBMED: 11248086. RA Xie W., Radominska-Pandya A., Shi Y., Simon C. M., Nelson M. C., Ong E. S., Waxman D. J., Evans R. M. RT An essential role for nuclear receptors SXR/PXR in detoxification of cholestatic bile acids. RL Proc. Natl. Acad. Sci. USA 98:3375-3380 (2001). XX //