TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04641 XX ID T04641 XX DT 25.07.2001 (created); mas. DT 15.04.2009 (updated); sva. CO Copyright (C), QIAGEN. XX FA PXR-isoform3 XX SY hPAR-2; NR1I2; PAR-2; pregnane X receptor; PXR; steroid and xenobiotic receptor; SXR. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002750 NR1I2; HGNC: NR1I2. XX CL C0002; CC (rec); 2.1.2.4.2.7. XX SZ 473 AA; 53.9 kDa (cDNA) (calc.). XX SQ MTVTRTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTE SQ SVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRK SQ GACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQ SQ GLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQ SQ VRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVI SQ SYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLE SQ PMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNR SQ PQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS XX SC translated from EMBL #AF084644 XX FT 37 325 PF00478; IMP dehydrogenase / GMP reductase domai. FT 77 149 SM00399; c4gold. FT 77 153 PS51030; NUCLEAR_REC_DBD_2. FT 78 154 DNA-binding domain [2]. FT 78 154 PF00105; Zinc finger, C4 type (two domains). FT 116 136 zinc finger 2 (C-X6-C-X9-C-X2-C), unusual spacing between first two cysteins (6 instead of 5 residues) [2]. FT 180 473 ligand-binding domain [2]. FT 284 443 SM00430; holi. FT 287 467 PF00104; Ligand-binding domain of nuclear hormon. XX CP (embryo:) intestinal mucosa (10 week old embryo, in situ) [2]; (adult:) liver, small intestine, colon [2] [2]. EX adipose tissue,,,embryo; none; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX adrenal gland (right and left),,,embryo; none; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; none; Northern blot; RNA (undefined); [2]. EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; none; Northern blot; RNA (undefined); [2]. EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; none; Northern blot; RNA (undefined); [2]. EX blood,monocyte,Circulatory System & Hematopoietic System,adult; none; Northern blot; RNA (undefined); [2]. EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; none; Northern blot; RNA (undefined); [2]. EX brain,,,adult; none; Northern blot; RNA (undefined); [2]. EX colon,,,adult; detectable; Northern blot; RNA (undefined); [2]. EX connective tissue,,,embryo; none; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX heart,,,adult; none; Northern blot; RNA (undefined); [2]. EX kidney (right and left),,,adult; none; Northern blot; RNA (undefined); [2]. EX liver,,,adult; detectable; Northern blot; RNA (undefined); [2]. EX lung (right and left),,,adult; none; Northern blot; RNA (undefined); [2]. EX mucosa of large intestine,,,embryo; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX mucosa of small intestine,,,embryo; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX muscles,,,adult; none; Northern blot; RNA (undefined); [2]. EX muscles,,,embryo; none; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX ovary (right and left),,,adult; none; Northern blot; RNA (undefined); [2]. EX pancreas,,,adult; none; Northern blot; RNA (undefined); [2]. EX placenta,,,adult; none; Northern blot; RNA (undefined); [2]. EX prostate gland,,,adult; none; Northern blot; RNA (undefined); [2]. EX skin,,,embryo; none; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX small intestine,,,adult; detectable; Northern blot; RNA (undefined); [2]. EX spleen,,,adult; none; Northern blot; RNA (undefined); [2]. EX testis (right and left),,,adult; none; Northern blot; RNA (undefined); [2]. EX thymus,,,adult; none; Northern blot; RNA (undefined); [2]. XX FF unprecedented broad range of ligands among nuclear receptor superfamily [1]; FF activating ligands are pregnenolone and its derivates (5beta-pregnane-3,20-dione methanesulfate is most potent activator), steroids (progesterone, 17alpha-hydroxypregnenolone, cortisol, 17beta-estradiol), rifampicin, clotrimazole [1] [2]; FF ligand spectrum different from rodent ortholog: for example not activated in the presence of 16alpha-carbonitrile in contrast to mouse ortholog T04618 [1]; XX MX M00966 V$DR3_Q4. MX M00965 V$DR4_Q2. MX M07280 V$NR1NR2_Q3. MX M00964 V$PXR_Q2. XX DR TRANSPATH: MO000028474. DR EMBL: AF084644; DR UniProtKB: O75469-7; XX RN [1]; RE0016488. RX PUBMED: 10628745. RA Jones S. A., Moore L. B., Shenk J. L., Wisely G. B., Hamilton G. A., McKee D. D., Tomkinson N. C., LeCluyse E. L., Lambert M. H., Willson T. M., Kliewer S. A., Moore J. T. RT The pregnane X receptor: a promiscuous xenobiotic receptor that has diverged during evolution RL Mol. Endocrinol. 14:27-39 (2000). RN [2]; RE0016501. RX PUBMED: 9770465. RA Bertilsson G., Heidrich J., Svensson K., Asman M., Jendeberg L., Sydow-Backman M., Ohlsson R., Postlind H., Blomquist P., Berkenstam A. RT Identification of a human nuclear receptor defines a new signaling pathway for CYP3A induction RL Proc. Natl. Acad. Sci. USA 95:12208-12213 (1998). XX //