TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04648 XX ID T04648 XX DT 01.08.2001 (created); mas. DT 07.03.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA ERR3-xbb1 XX SY ERR gamma1; ERR3-1; ESRRG; estrogen receptor related protein 3; estrogen-related receptor gamma; NR3B3. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002761 ESRRG; HGNC: ESRRG. XX CL C0002; CC (rec). XX SZ 436 AA; 48.7 kDa (cDNA) (calc.). XX SQ MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPP SQ LYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVA SQ SCEACKASFKRKIQANIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRV SQ RGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIK SQ ALTTLCDCADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGFVYRSLSFEDE SQ LVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIE SQ DVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGK SQ VPMHKLFLEMLEAKVC XX SC translated from EMBL #AF058291 XX FT 102 173 SM00399; c4gold. FT 102 177 PS51030; NUCLEAR_REC_DBD_2. FT 103 178 PF00105; Zinc finger, C4 type (two domains). FT 247 405 SM00430; holi. FT 250 430 PF00104; Ligand-binding domain of nuclear hormon. XX EX adrenal gland (right and left),,,adult; detectable; Northern blot; RNA (undefined); [1]. EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [2]. EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [2]. EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [2]. EX blood,monocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [2]. EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [2]. EX bone marrow,,,adult; detectable; Northern blot; RNA (undefined); [1]. EX brain,,,adult; low; Northern blot; RNA (undefined); [1]. EX brain,,,adult; medium; RT-PCR; RNA (undefined); [2]. EX brain,,,fetal; very high; Northern blot; RNA (undefined); [1]. EX brain,,,fetal; very low; RT-PCR; RNA (undefined); [2]. EX central nervous system,,,embryo; detectable; Northern blot; RNA (undefined); [1]. EX colon,,,adult; very low; RT-PCR; RNA (undefined); [2]. EX heart,,,adult; medium; RT-PCR; RNA (undefined); [2]. EX heart,,,adult; none; Northern blot; RNA (undefined); [1]. EX heart,,,fetal; very high; RT-PCR; RNA (undefined); [2]. EX kidney (right and left),,,adult; high; RT-PCR; RNA (undefined); [2]. EX kidney (right and left),,,adult; none; Northern blot; RNA (undefined); [1]. EX kidney (right and left),,,fetal; detectable; Northern blot; RNA (undefined); [1]. EX kidney (right and left),,,fetal; very high; RT-PCR; RNA (undefined); [2]. EX liver,,,adult; none; RT-PCR; RNA (undefined); [2]. EX liver,,,fetal; detectable; Northern blot; RNA (undefined); [1]. EX liver,,,fetal; none; RT-PCR; RNA (undefined); [2]. EX lung (right and left),,,adult; detectable; Northern blot; RNA (undefined); [1]. EX lung (right and left),,,adult; low; RT-PCR; RNA (undefined); [2]. EX lung (right and left),,,fetal; detectable; Northern blot; RNA (undefined); [1]. EX lung (right and left),,,fetal; very low; RT-PCR; RNA (undefined); [2]. EX lymph node,,,adult; none; Northern blot; RNA (undefined); [1]. EX muscles,,,adult; low; RT-PCR; RNA (undefined); [2]. EX muscles,,,adult; none; Northern blot; RNA (undefined); [1]. EX muscles,,,fetal; low; RT-PCR; RNA (undefined); [2]. EX ovary (right and left),,,adult; very low; RT-PCR; RNA (undefined); [2]. EX pancreas,,,adult; high; RT-PCR; RNA (undefined); [2]. EX placenta,,,adult; medium; RT-PCR; RNA (undefined); [2]. EX prostate gland,,,adult; medium; RT-PCR; RNA (undefined); [2]. EX retina,,,adult; very high; RT-PCR; RNA (undefined); [2]. EX small intestine,,,adult; low; RT-PCR; RNA (undefined); [2]. EX small intestine,,,adult; none; Northern blot; RNA (undefined); [1]. EX spinal cord,,,adult; detectable; Northern blot; RNA (undefined); [1]. EX spleen,,,adult; low; RT-PCR; RNA (undefined); [2]. EX spleen,,,fetal; none; RT-PCR; RNA (undefined); [2]. EX stomach,,,adult; none; Northern blot; RNA (undefined); [1]. EX testis (right and left),,,adult; low; RT-PCR; RNA (undefined); [2]. EX thymus,,,adult; low; RT-PCR; RNA (undefined); [2]. EX thymus,,,fetal; none; RT-PCR; RNA (undefined); [2]. EX thyroid gland,,,adult; detectable; Northern blot; RNA (undefined); [1]. EX trachea,,,adult; detectable; Northern blot; RNA (undefined); [1]. XX DR TRANSPATH: MO000028481. DR EMBL: AF058291; DR UniProtKB: P62508; XX RN [1]; RE0016530. RX PUBMED: 9676434. RA Eudy J. D., Yao S., Weston M. D., Ma-Edmonds M., Talmadge C. B., Cheng J. J., Kimberling W. J., Sumegi J. RT Isolation of a gene encoding a novel member of the nuclear receptor superfamily from the critical region of Usher syndrome type IIa at 1q41 RL Genomics 50:382-384 (1998). RN [2]; RE0016531. RX PUBMED: 10707956. RA Heard D. J., Norby P. L., Holloway J., Vissing H. RT Human ERRgamma, a third member of the estrogen receptor-related receptor (ERR) subfamily of orphan nuclear receptors: tissue-specific isoforms are expressed during development and in the adult RL Mol. Endocrinol. 14:382-392 (2000). XX //