TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08404 XX ID T08404 XX DT 17.01.2006 (created); ili. DT 01.08.2014 (updated); sla. CO Copyright (C), QIAGEN. XX FA p53-isoform4 XX SY Del40-p53; Del40-p53alpha; Delta40p53; DeltaNp53; p47; p53; tp53; TRP53; tumor protein p53 (Li-Fraumeni syndrome). XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G001075 TP53; HGNC: tp53. XX CL C0057; P53; 6.3.1.0.1.4. XX SZ 354 AA; 39.3 kDa (calc.), 47 kDa [1] XX SQ MDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPS SQ QKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRA SQ MAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVP SQ YEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPG SQ RDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFE SQ MFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD XX SC UniProt #P04637, edited according to [1] XX FT 56 250 PF00870; P53 DNA-binding domain. FT 279 320 PF07710; P53 tetramerisation motif. XX CP lymphocytes [1]. XX FF not able to induce transcription alone [1]; FF does not suppress cell viability but controls p53-mediated suppression of cell viability [1]; FF able to shift the localization of p53 from the nucleus to the cytoplasm [1]; FF potent inhibitor of p53 transcriptional transactivation activity even in the presence of equal or higher levels of p53 [1]; XX IN T08404 p53-isoform4; human, Homo sapiens. IN T00671 p53; human, Homo sapiens. XX MX M00761 V$P53DECAMER_Q2. MX M00034 V$P53_01. MX M00272 V$P53_02. MX M01651 V$P53_03. MX M01652 V$P53_04. MX M07054 V$P53_Q3_01. XX DR TRANSPATH: MO000057270. DR UniProtKB: P04637-4; XX RN [1]; RE0035678. RX PUBMED: 15340061. RA Ghosh A., Stewart D., Matlashewski G. RT Regulation of human p53 activity and cell localization by alternative splicing. RL Mol. Cell. Biol. 24:7987-7997 (2004). XX //