TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09118 XX ID T09118 XX DT 26.07.2006 (created); jag. DT 06.06.2014 (updated); spk. CO Copyright (C), QIAGEN. XX FA Sp1-isoform1 XX SY Sp1; Stimulating Protein 1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004918 Sp1. XX CL C0001; CH. XX SZ 784 AA; 80.7 kDa (cDNA) (calc.), 95/105 kDa (SDS) XX SQ MSDQDHSMDEVTAVVKIEKDVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQP SQ SPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATP SQ TSKEQSGNSTNGSNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQ SQ FQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIIPNEGSGGNIIAAMPNLLQQAVPL SQ QGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESSSQP SQ VTSGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTSSGSSGTSSQGQTPQR SQ VGGLQGSDSLNIQQNQTSGGSLQGSQQKEGEQSQQTQQQQILIQPQLVQGGQALQALQAA SQ PLSGQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQ SQ AQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALG SQ TSGIQVHQLPGLPLAIANTPGDHGTQLGLHGSGGDGIHDETAGGEGENSSDLQPQAGRRT SQ RREACTCPYCKDSEGRASGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCN SQ WSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVAL SQ SVGTLPLDSGAGSEGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVTELQSINIS SQ GNGF XX SC translated from EMBL #AF022363 XX FT 231 681 PF00478; IMP dehydrogenase / GMP reductase domain. FT 627 651 PF00096; zf-C2H2. FT 627 651 SM00355; c2h2final6. FT 627 656 PS50157; ZINC_FINGER_C2H2_2. FT 657 681 PF00096; zf-C2H2. FT 657 681 SM00355; c2h2final6. FT 657 686 PS50157; ZINC_FINGER_C2H2_2. FT 687 709 PF00096; zf-C2H2. FT 687 709 SM00355; c2h2final6. FT 687 714 PS50157; ZINC_FINGER_C2H2_2. XX IN T21984 p300; human, Homo sapiens. IN T00545 POU2F1; human, Homo sapiens. XX MX M00008 V$SP1_01. MX M00933 V$SP1_Q2_01. MX M07395 V$SP1_Q2_02. MX M00932 V$SP1_Q4_01. MX M00196 V$SP1_Q6. MX M00931 V$SP1_Q6_01. XX BS R01762. BS R14212. BS R14213. BS R15681. BS R15353. BS R03336. BS R01694. BS R02381. BS R01769. BS R15653. BS R04025. XX DR TRANSPATH: MO000083597. DR EMBL: AF022363; DR UniProtKB: O89090-1; SP1_MOUSE. XX RN [1]; RE0000182. RX PUBMED: 2170018. RA Jackson S. P., MacDonald J. J., Lees-Miller S., Tjian R. RT GC box binding induces phosphorylation by a DNA-dependent protein kinase RL Cell 63:155-165 (1990). RN [2]; RE0000692. RX PUBMED: 2163346. RA Saffer J. D., Jackson S. P., Thurston S. J. RT SV40 stimulates expression of the trans-acting factor Sp1 at the mRNA level RL Genes Dev. 4:659-666 (1990). RN [3]; RE0000693. RX PUBMED: 1851121. RA Su W., Jackson S., Tjian R., Echols H. RT DNA looping between site for transcriptional activation: self-association of DNA-bound Sp1 RL Genes Dev. 5:820-826 (1991). RN [4]; RE0001271. RX PUBMED: 2181288. RA Lemaigre F. P., Lafontaine D. A., Courtois S. J., Durviaux S. M., Rousseau G. G. RT Sp1 can displace GHF-1 from its distal binding site and stimulate transcription from the growth hormone gene promoter RL Mol. Cell. Biol. 10:1811-1814 (1990). RN [5]; RE0001375. RX PUBMED: 2677669. RA Schmidt M. C., Zhou Q., Berk A. J. RT Sp1 Activates Transcription without Enhancing DNA-Binding Activity of the TATA Box Factor RL Mol. Cell. Biol. 9:3299-3307 (1989). RN [6]; RE0001495. RX PUBMED: 2005904. RA Saffer J. D., Jackson S. P., Annarella M. B. RT Developmental expression of Sp1 in the mouse RL Mol. Cell. Biol. 11:2189-2199 (1991). RN [7]; RE0001631. RX PUBMED: 1710025. RA Pecorino L. T., Darrow A. L., Strickland S. RT In vitro analysis of the tissue plasminogen activator promoter reveals a GC box-binding activity present in murine brain but undetectable in kidney and liver RL Mol. Cell. Biol. 11:3139-3147 (1991). RN [8]; RE0002175. RX PUBMED: 1886769. RA Somma M. P., Gambino I., Lavia P. RT Transcription factors binding to the mouse HTF9 housekeeping promoter differ between cell types RL Nucleic Acids Res. 19:4451-4458 (1991). RN [9]; RE0002618. RX PUBMED: 3103216. RA Seguin C., Hamer D. H. RT Regulation in Vitro of Metallothionein Gene Binding Factors RL Science 235:1383-1387 (1987). RN [10]; RE0002766. RX PUBMED: 2325642. RA Hirsch M.-R., Gaugler L., Deagostini-Bazin H., Bally-Cuif L., Goridis C. RT Identification of Positive and Negative Regulatory Elements Governing Cell-Type-Specific Expression of the Neural Cell Adhesion Molecule Gene RL Mol. Cell. Biol. 10:1959-1968 (1990). RN [11]; RE0006719. RX PUBMED: 8016096. RA Perez J. R., Li Y., Stein C. A., Majumder S., van Oorschot A. RT Sequence-independent induction of Sp1 trasncription factor activity by phosphorothioate oligodeoxynucleotides RL Proc. Natl. Acad. Sci. USA 91:5957-5961 (1994). RN [12]; RE0010577. RX PUBMED: 7739528. RA Merika M., Orkin S. H. RT Functional synergy and physical interactions of the erythroid transcription factor GATA-1 with the Krueppel family proteins Sp1 and EKLF RL Mol. Cell. Biol. 15:2437-2447 (1995). RN [13]; RE0016556. RX PUBMED: 2123467. RA Sartorelli V., Webster K. A., Kedes L. RT Muscle-specific expression of the cardiac alpha-actin gene requires MyoD, CArG-box binding factor, and Sp1. RL Genes Dev. 4:1811-1822 (1990). RN [14]; RE0064368. RX PUBMED: 19070619. RA Lim K., Chang H. I. RT O-GlcNAc modification of Sp1 inhibits the functional interaction between Sp1 and Oct1. RL FEBS Lett. 583:512-520 (2009). XX //