AC T09218
XX
ID T09218
XX
DT 14.08.2006 (created); din.
DT 14.07.2014 (updated); pro.
CO Copyright (C), QIAGEN.
XX
FA Msx-1
XX
SY Chox-7 (chick); Ghox-7 (chick); Hox-7; Hox-7.1.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G006440 Msx1.
XX
CL C0006; homeo.
XX
SZ 293 AA; 30.8 kDa (cDNA) (calc.).
XX
SQ MTSLPLGVKVEDSAFAKPAGGGVGQAPGAAAATATAMGTDEEGAKPKVPASLLPFSVEAL
SQ MADHRKPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVGGLLKL
SQ PEDALVKAESPEKLDRTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLA
SQ LERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPML
SQ PPAAFGLSFPLGGPAAAGASLYSASGPFQRAALPVAPVGLYTAHVGYSMYHLT
XX
SC Swiss-Prot#P13297
XX
FT 164 224 
PS50071; HOMEOBOX_2.
FT 166 228 
SM00389; HOX_1.
FT 167 223 
PF00046; Homeobox domain.
XX
IN T03235 Grg-5; mouse, Mus musculus.
IN T09219 Grg4; mouse, Mus musculus.
IN T00545 POU2F1; human, Homo sapiens.
XX
MX M00394 V$MSX1_01.
MX M01412 V$MSX1_02.
MX M07298 V$MSX1_Q5.
MX M08822 V$MSX1_Q5_01.
XX
BS R09067.
BS R09068.
BS R09069.
BS R09070.
BS R09071.
BS R09072.
BS R09073.
BS R09074.
BS R09075.
BS R09076.
BS R09077.
BS R09078.
BS R09079.
BS R62871.
BS R62875.
BS R15355.
BS R36601.
XX
DR TRANSPATH: MO000085013.
DR EMBL: M38575;
DR EMBL: X14457;
DR EMBL: X14759;
DR EMBL: X59251;
DR UniProtKB: P13297;
XX
RN [1]; RE0003871.
RX PUBMED: 8096059.
RA Catron K. M., Iller N., Abate C.
RT Nucleotides flanking a conserved TAAT core dictate the DNA binding specifity of three murine homeodomain proteins
RL Mol. Cell. Biol. 13:2354-2365 (1993).
RN [2]; RE0005151.
RX PUBMED: 1685479.
RA Hewitt J. E., Clarke L. E., Iven A., Williamson R.
RT Structure and sequence of the human homeobox gene HOX7
RL Genomics 11:670-678 (1991).
RN [3]; RE0005152.
RX PUBMED: 1682128.
RA Monaghan A. P., Davidson D. R., Sime C. M., Graham E., Baldock R., Bhattacharya S. S., Hill R. E.
RT The Msh-like homeobox genes define domains in the developing vertebrate eye
RL Development 112:1053-1061 (1991).
RN [4]; RE0005153.
RX PUBMED: 2565278.
RA Hill R. E., Jones P. F., Rees A. R., Sime C. M., Justice M. J., Copeland N. G., Jenkins N. A., Graham E., Davidson D. R.
RT A new family of mouse homeo box-containing genes: molecular structure, chromosomal location, and developmental expression of Hox-7.1
RL Genes Dev. 3:26-37 (1989).
RN [5]; RE0005154.
RX PUBMED: 2565810.
RA Robert B., Sassoon D., Jacq B., Gehring W., Buckingham M.
RT Hox-7, a mouse homeobox gene with a novel pattern of expression during embryogenesis
RL EMBO J. 8:91-100 (1989).
RN [6]; RE0005155.
RX PUBMED: 1673109.
RA Holland P. W.
RT Cloning and evolutionary analysis of msh-like homeobox genes from mouse, zebrafish and ascidian
RL Gene 98:253-257 (1991).
RN [7]; RE0005159.
RX PUBMED: 1677742.
RA Davidson D. R., Crawley A., Hill R. E., Tickle C.
RT Position-dependent expression of two related homeobox genes in developing vertebrate limbs
RL Nature 352:429-431 (1991).
RN [8]; RE0005160.
RX PUBMED: 7915838.
RA Shang Z., Isaac V. E., Li H., Patel L., Catron K. M., Curran T., Montelione G. T., Abate C.
RT Design of a 'minimAl' homeodomain: The N-terminal arm modulates DNA binding affinity and stabilizes homeodomain structure
RL Proc. Natl. Acad. Sci. USA 91:8373-8377 (1994).
RN [9]; RE0006697.
RX PUBMED: 9226442.
RA Shimamura K., Rubenstein J. L. R.
RT Inductive interactions direct early regionalization of the mouse forebrain
RL Development 124:2709-2718 (1997).
RN [10]; RE0010105.
RX PUBMED: 7823952.
RA Catron K. M., Zhang H., Marshall S. C., Inostroza J. A., Wilson J. M., Abate C.
RT Transcriptional repression by Msx-1 does not require homeodomain DNA-binding sites
RL Mol. Cell. Biol. 15:861-871 (1995).
RN [11]; RE0014818.
RA Pekkanen M., Nieminen P., Sahlberg C., Aberg T., Thesleff I.
RT Gene expression in tooth (WWW database); URL: http://bite-it.helsinki.fi/MSX1.htm
RL Internet : (1996).
RN [12]; RE0015954.
RX PUBMED: 9671575.
RA Thomas T., Kurihara H., Yamagishi H., Kurihara Y., Yazaki Y., Olson E. N., Srivastava D.
RT A signaling cascade involving endothelin-1, dHAND and Msx1 regulates development of neural-crest-derived branchial arch mesenchyme
RL Development 125:3005-3014 (1998).
RN [13]; RE0024536.
RX PUBMED: 9369446.
RA Sarapura V. D., Strouth H. L., Gordon D. F., Wood W. M., Ridgway E. C.
RT Msx1 is present in thyrotropic cells and binds to a consensus site on the glycoprotein hormone alpha-subunit promoter.
RL Mol. Endocrinol. 11:1782-1794 (1997).
RN [14]; RE0047958.
RX PUBMED: 16002402.
RA Rave-Harel N., Miller N. L., Givens M. L., Mellon P. L.
RT The Groucho-related gene family regulates the gonadotropin-releasing hormone gene through interaction with the homeodomain proteins MSX1 and OCT1.
RL J. Biol. Chem. 280:30975-30983 (2005).
XX
//