AC T09234
XX
ID T09234
XX
DT 16.08.2006 (created); din.
CO Copyright (C), QIAGEN.
XX
FA HOXB1-isoform1
XX
SY homeo box B1; Hox-2.9; HOX2I; HOXB1.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004684 HOXB1; HGNC: HOXB1.
XX
CL C0006; homeo.
XX
SZ 301 AA; 32.1 kDa (cDNA) (calc.).
XX
SQ MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQN
SQ SGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQL
SQ GGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTF
SQ DWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATL
SQ ELNETQVKIWFQNRRMKQKKREREGGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVT
SQ S
XX
SC Swiss-Prot#P14653
XX
FT 1 155 
transactivation domain [10].
FT 201 261 
PS50071; HOMEOBOX_2.
FT 203 265 
SM00389; HOX_1.
FT 204 260 
PF00046; Homeobox domain.
XX
IN T00682 Pax-6; zebra fish, Brachydanio rerio.
XX
BS R15357.
BS R14719.
BS R09699.
BS R12755.
BS R32602.
BS R32606.
XX
DR TRANSPATH: MO000085084.
DR EMBL: X16666;
DR UniProtKB: P14653;
XX
RN [1]; RE0003886.
RX PUBMED: 2576652.
RA Boncinelli E., Acampora D., Pannese M., D'Esposito M., Somma R., Gaudino G., Stornaiuolo A., Cafiero M., Faiella A., Simeone A.
RT Organization of human class I homeobox genes
RL Genome 31:745-756 (1989).
RN [2]; RE0003895.
RX PUBMED: 2574852.
RA Acampora D., D'Esposito M., Faiella A., Pannese M., Migliaccio E., Morelli F., Stornaiuolo A., Nigro V., Simeone A., Boncinelli E.
RT The human HOX gene family
RL Nucleic Acids Res. 17:10385-10402 (1989).
RN [3]; RE0003909.
RX PUBMED: 7831296.
RA Ogura T., Evans R. M.
RT A retinoic acid-triggered cascade of HOXB1 gene activation
RL Proc. Natl. Acad. Sci. USA 92:387-391 (1995).
RN [4]; RE0003910.
RX PUBMED: 7831297.
RA Ogura T., Evans R. M.
RT Evidence for two distinct retinoic acid response pathways for HOXB1 gene regulation
RL Proc. Natl. Acad. Sci. USA 92:392-396 (1995).
RN [5]; RE0003920.
RX PUBMED: 1712489.
RA Magli M. C., Barba P., Celetti A., de Vita G., Cillo C., Boncinelli E.
RT Coordinate regulation of HOX genes in human hematopoietic cells
RL Proc. Natl. Acad. Sci. USA 88:6348-6352 (1991).
RN [6]; RE0003921.
RX PUBMED: 1975088.
RA Simeone A., Acampora D., Arcioni L., Andrews P. W., Boncinelli E., Mavilio F.
RT Sequential activation of HOX2 homeobox genes by retinoic acid in human embryonal carcinoma cells
RL Nature 346:763-766 (1990).
RN [7]; RE0003924.
RX PUBMED: 1360433.
RA Safaei R., Prochazka V., Detmer K., Boncinelli E., Lawrence H. J., Largman C.
RT Modulation of HOX2 gene expression following differentiation of neural cell lines
RL Differentiation 5:39-47 (1992).
RN [8]; RE0003925.
RX PUBMED: 7911974.
RA Care A., Testa U., Bassani A., Tritarelli E., Montesoro E., Samoggia P., Cianetti L., Peschle C.
RT Coordinate expression and proliferative role of HOXB genes in activated adult T lymphocytes
RL Mol. Cell. Biol. 14:4872-4877 (1994).
RN [9]; RE0003926.
RX PUBMED: 7911240.
RA Faiella A., Zappavigna V., Mavilio F., Boncinelli E.
RT Inhibition of retinoic acid-induced activation of 3' human HOXB genes by antisense oligonucleotides affects sequential activation of genes located upstream in the four HOX clusters
RL Proc. Natl. Acad. Sci. USA 91:5335-5339 (1994).
RN [10]; RE0005973.
RX PUBMED: 9218805.
RA Rocco di G., Mavilio F., Zappavigna V.
RT Functional dissection of a transcripitonally active, target-specific Hox-Pbx complex
RL EMBO J. 16:3644-3654 (1997).
RN [11]; RE0015483.
RX PUBMED: 11091361.
RA Ingram J. L., Stodgell C. J., Hyman S. L., Figlewicz D. A., Weitkamp L. R., Rodier P. M.
RT Discovery of allelic variants of HOXA1 and HOXB1: Genetic susceptibility to autism spectrum disorders
RL Teratology 62:393-405 (2000).
RN [12]; RE0015500.
RX PUBMED: 9482740.
RA Berthelsen J., Zappavigna V., Ferretti E., Mavilio F., Blasi F.
RT The novel homeoprotein Prep1 modulates Pbx-Hox protein cooperativity
RL EMBO J. 17:1434-1445 (1998).
RN [13]; RE0047970.
RX PUBMED: 11069920.
RA Mikkola I., Bruun J. A., Holm T., Johansen T.
RT Superactivation of Pax6-mediated transactivation from paired domain-binding sites by dna-independent recruitment of different homeodomain proteins.
RL J. Biol. Chem. 276:4109-4118 (2001).
XX
//