AC T09237
XX
ID T09237
XX
DT 17.08.2006 (created); sri.
DT 08.06.2012 (updated); jtr.
CO Copyright (C), QIAGEN.
XX
FA TFIIA-gamma
XX
SY general transcription factor IIA, 2, 12kDa; GTF2A2; TF2A2; TFIIA; TFIIA p12 subunit; TFIIA-12; TFIIA-gamma; TFIIA-S; TFIIAS; transcription initiation factor IIA gamma chain.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G003995 GTF2A2; HGNC: GTF2A2.
XX
SZ 109 AA; 12.5 kDa (cDNA) (calc.), 12 kDa (SDS) [5], 13 kDa (SDS) [1] [4] [5] [4] [1]
XX
SQ MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRG
SQ SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
XX
SC Swiss-Prot#P52657
XX
FT 1 49 
PF02268; Transcription initiation factor IIA, ga.
FT 51 100 
PF02751; Transcription initiation factor IIA, ga.
XX
IN T01042 HSF1-L; human, Homo sapiens.
XX
BS R39026.
XX
DR TRANSPATH: MO000085141.
DR EMBL: U14193;
DR EMBL: U21242;
DR EMBL: X81713;
DR UniProtKB: P52657;
XX
RN [1]; RE0005655.
RX PUBMED: 1729613.
RA Cortes P., Flores O., Reinberg D.
RT Factors involved in specific transcription by mammalian RNA polymerase II: Purification and analysis of transcription factor IIA and identification of transcription factor IIJ
RL Mol. Cell. Biol. 12:413-421 (1992).
RN [2]; RE0005656.
RX PUBMED: 7958899.
RA Ozer J., Moore P. A., Bolden A. H., Lee A., Rosen C. A., Lieberman P. M.
RT Molecular cloning of the small (gamma) subunit of human TFIIA reveals functions critical for activated transcription
RL Genes Dev. 8:2324-2335 (1994).
RN [3]; RE0005657.
RX PUBMED: 7958900.
RA Sun X., Ma D., Sheldon M., Yeung K., Reinberg D.
RT Reconstitution of human TFIIA activity from recombinant polypeptides: a role in TFIID-mediated transcription
RL Genes Dev. 8:2336-2348 (1994).
RN [4]; RE0005658.
RX PUBMED: 8224850.
RA Ma D., Watanabe H., Mermelstein F., Admon A., Oguri K., Sun X., Wada T., Imai T., Shiroya T., Reinberg D., Handa H.
RT Isolation of a cDNA encoding the largest subunit of TFIIA reveals functions important for activated transcription
RL Genes Dev. 7:2246-2257 (1993).
RN [5]; RE0005659.
RX PUBMED: 8224848.
RA Dejong J., Roeder R. G.
RT A single cDNA hTFIIA/alpha encodes both the p35 and p19 subunits of human TFIIA
RL Genes Dev. 7:2220-2234 (1993).
RN [6]; RE0005663.
RX PUBMED: 7724559.
RA Dejong J., Bernstein R., Roeder R. G.
RT Human general transcription factor TFIIA: Characterization of a cDNA encoding the small subunit and requirement for basal and activated transcription
RL Proc. Natl. Acad. Sci. USA 92:3313-3317 (1995).
RN [7]; RE0031850.
RX PUBMED: 11005381.
RA Yuan C. X., Gurley W. B.
RT Potential targets for HSF1 within the preinitiation complex.
RL Cell Stress Chaperones 5:229-42 (2000).
XX
//