AC T09254
XX
ID T09254
XX
DT 23.08.2006 (created); jul.
DT 21.02.2014 (updated); pos.
CO Copyright (C), QIAGEN.
XX
FA c-Rel
XX
SY c-Rel; HIVEN86A; Nuclear Factor kappa B c-Rel; p68; p82(hc-rel).
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004960 REL; HGNC: REL.
XX
CL C0020; Rel.
XX
SZ 619 AA; 68.5 kDa (cDNA) (calc.), 82-85 kDa (SDS) [2]
XX
SQ MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
SQ VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
SQ TRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
SQ PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
SQ AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
SQ QKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYF
SQ KKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTP
SQ RSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSA
SQ DLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMS
SQ SSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGI
SQ GSMQNEQLSDSFPYEFFQV
XX
SC Swiss-Prot#Q04864
XX
FT 5 182 
PS50254; REL_2.
FT 10 178 
PF00554; Rel homology domain (RHD).
FT 185 280 
SM00429; iptmega2.
FT 186 280 
PF01833; IPT/TIG domain.
FT 197 619 
PF00478; IMP dehydrogenase / GMP reductase domain.
XX
IN T09254 c-Rel; human, Homo sapiens.
IN T22508 dpf2-isoform1; human, Homo sapiens.
XX
MX M00053 V$CREL_01.
MX M03545 V$CREL_Q6.
XX
BS R01748.
BS R56830.
BS R56831.
BS R56846.
BS R56841.
BS R56833.
BS R56844.
BS R56879.
BS R24146.
BS R56894.
BS R56884.
BS R56892.
BS R30575.
BS R30566.
BS R56860.
BS R00941.
BS R30568.
BS R56896.
BS R22506.
BS R22617.
BS R56876.
BS R56885.
BS R56877.
BS R56878.
BS R56886.
BS R56865.
BS R56872.
BS R56881.
XX
DR TRANSPATH: MO000085500.
DR EMBL: M11595; HSCRELA.
DR EMBL: X75042;
DR UniProtKB: Q04864; REL_HUMAN.
XX
RN [1]; RE0000100.
RX PUBMED: 2836068.
RA Boehnlein E., Lowenthal J. W., Siekevitz M., Ballard D. W., Franza B. R., Greene W. C.
RT The Same Inducible Nuclear Protein Regulates Mitogen Activation of Both the Interleukin-2 Receptor-Alpha Gene and Type 1 HIV
RL Cell 53:827-836 (1988).
RN [2]; RE0000216.
RX PUBMED: 2225078.
RA Ballard D. W., Walker W. H., Doerre S., Sista P., Molitor J. A., Dixon E. P., Peffer N. J., Hannink M., Greene W. C.
RT The v-rel oncogene encodes a kappaB enhancer binding protein that inhibits NF-kappaB function
RL Cell 63:803-814 (1990).
RN [3]; RE0001791.
RX PUBMED: 2825023.
RA Franza jr B. R., Josephs S. F., Gilman M. Z., Ryan W., Clarkson B.
RT Characterization of cellular proteins recognizing the HIV enhancer using a microscale DNA-affinity precipitation assay
RL Nature 330:391-395 (1987).
RN [4]; RE0002417.
RX PUBMED: 2263603.
RA Molitor J. A., Walker W. H., Doerre S., Ballard D. W., Greene W. C.
RT NF-kappaB: a family of inducible and differentially expressed enhancer-binding proteins in human T cells
RL Proc. Natl. Acad. Sci. USA 87:10028-10032 (1990).
RN [5]; RE0002922.
RX PUBMED: 1406630.
RA Kunsch C., Ruben S. M., Rosen C. A.
RT Selection of optimal kappaB/Rel DNA-binding motifs: interaction of both subunits of NF-kappaB with DNA is required for transcriptional activation
RL Mol. Cell. Biol. 12:4412-4421 (1992).
RN [6]; RE0004480.
RX PUBMED: 3016517.
RA Brownell E., Brien S. J., Nash W. G., Rice N.
RT Genetic characterization of human c-rel sequences
RL Mol. Cell. Biol. 5:2826-2831 (1985).
RN [7]; RE0004507.
RX PUBMED: 7925300.
RA Naumann M., Scheidereit C.
RT Activation of NF-6B in vivo is regulated by multiple phosphorylations
RL EMBO J. 13:4597-4607 (1994).
RN [8]; RE0004559.
RX PUBMED: 1740106.
RA Hansen S. K., Nerlov C., Zabel U., Verde P., Johnsen M., Baeuerle P., Blasi F.
RT A novel complex between the p65 subunit of NF-kappaB and c-Rel binds to a DNA element involved in the phorbol ester induction of the human urokinase gene
RL EMBO J. 11:205-213 (1992).
RN [9]; RE0004565.
RX PUBMED: 7935451.
RA Sun S.-C., Elwood J., Beraud C., Greene W. C.
RT Human T-cell leukemia virus type I Tax activation of NF-kappaB/Rel involves phosphorylation and degradation of IkappaBalpha and RelA (p65)-mediated induction of the c-rel gene
RL Mol. Cell. Biol. 14:7377-7384 (1994).
RN [10]; RE0004574.
RX PUBMED: 1903456.
RA Richardson P. M., Gilmore T. D.
RT vRel is an inactive member of the Rel family of transcriptional activating proteins
RL J. Virol. 65:3122-3130 (1991).
RN [11]; RE0004575.
RX PUBMED: 1542667.
RA Sica A., Tan T.-H., Rice N. R., Kretzschmar M., Ghosh P., Young H. A.
RT The c-rel protooncogene product c-Rel but not NF-6B binds to the intronic region of the human interferon-gamma gene at a site related to an interferon-stimulable response gene
RL Proc. Natl. Acad. Sci. USA 89:1740-1744 (1992).
RN [12]; RE0004576.
RX PUBMED: 8455941.
RA Crenon I., Beraud C., Simard P., Montagne J., Veschambre P., Jalinot P.
RT The transcriptionally active factors mediating the effect of the HTLV-I Tax transactivator on the IL-2Ralpha kappaB enhancer include the product of the c-rel proto-oncogene
RL Oncogene 8:867-875 (1993).
RN [13]; RE0004577.
RX PUBMED: 8413585.
RA Kerr L. D., Ransone L. J., Wamsley P., Schmitt M. J., Boyer T. G., Zhou Q., Berk A. J., Verma I. M.
RT Association between proto-oncoprotein Rel and TATA-binding protein mediates transcriptional activation by NF-kappaB
RL Nature 365:412-419 (1993).
RN [14]; RE0004580.
RX PUBMED: 8430069.
RA Doerre S., Sista P., Sun S.-C., Ballard D. W., Greene W. C.
RT The c-rel protooncogene product represses NF-kappaB p65-mediated transcriptional activation of the long terminal repeat of type 1 human immunodeficiency virus
RL Proc. Natl. Acad. Sci. USA 90:1023-1027 (1993).
RN [15]; RE0004581.
RX PUBMED: 8139561.
RA Hansen S. K., Baeuerle P. A., Blasi F.
RT Purification, reconstitution, and IkappaB association of the c-RelBp65 (RelA) complex, a strong activator of transcription
RL Mol. Cell. Biol. 14:2593-2603 (1994).
RN [16]; RE0051535.
RX PUBMED: 16585559.
RA Sanchez-Valdepenas C., Martin A. G., Ramakrishnan P., Wallach D., Fresno M.
RT NF-kappaB-inducing kinase is involved in the activation of the CD28 responsive element through phosphorylation of c-Rel and regulation of its transactivating activity.
RL J. Immunol. 176:4666-4674 (2006).
RN [17]; RE0054190.
RX PUBMED: 12820969.
RA Saccani S., Pantano S., Natoli G.
RT Modulation of NF-kappaB activity by exchange of dimers.
RL Mol. Cell 11:1563-1574 (2003).
RN [18]; RE0070954.
RX PUBMED: 20460684.
RA Tando T., Ishizaka A., Watanabe H., Ito T., Iida S., Haraguchi T., Mizutani T., Izumi T., Isobe T., Akiyama T., Inoue J., Iba H.
RT Requiem protein links RelB/p52 and the Brm-type SWI/SNF complex in a noncanonical NF-kappaB pathway.
RL J. Biol. Chem. 285:21951-21960 (2010).
XX
//