AC T09328
XX
ID T09328
XX
DT 20.09.2006 (created); man.
DT 04.07.2014 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA USF1-isoform1
XX
SY eUSF (duck); MLTF; MRF (yeast); pf51; UEF; upstream stimulatory factor; Upstream Stimulatory Factor 1; USF; USF1; USF43.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004131 USF1; HGNC: USF1.
XX
CL C0012; bHLH-ZIP.
XX
SZ 310 AA; 33.5 kDa (cDNA) (calc.), 43-55 kDa (SDS)
XX
SQ MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
SQ YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP
SQ STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP
SQ RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK
SQ GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG
SQ LEVVIKNDSN
XX
SC Swiss-Prot#P22415-1
XX
FT 198 255 
PS50888; HLH.
FT 200 255 
PF00010; Helix-loop-helix DNA-binding domain.
FT 205 260 
SM00353; finulus.
XX
IN T00306 GATA-1; human, Homo sapiens.
XX
MX M01034 V$EBOX_Q6_01.
MX M07067 V$USF1_Q4.
MX M00121 V$USF_01.
MX M00122 V$USF_02.
MX M00217 V$USF_C.
MX M00187 V$USF_Q6.
MX M00796 V$USF_Q6_01.
XX
BS R00992.
BS R02082.
BS R03501.
BS R02015.
BS R18534.
BS R04464.
BS R26159.
BS R13028.
BS R13029.
BS R13030.
BS R29834.
BS R04408.
BS R04454.
BS R04351.
BS R04420.
BS R14387.
BS R57299.
BS R17166.
BS R17167.
BS R17168.
BS R23849.
BS R23902.
BS R16968.
BS R18829.
BS R18830.
BS R29718.
BS R31489.
BS R41532.
BS R24689.
BS R37669.
BS R04412.
BS R00853.
BS R03103.
BS R13272.
BS R18865.
BS R19438.
BS R26755.
BS R26822.
BS R00443.
BS R04436.
BS R23901.
BS R04439.
BS R01437.
XX
DR TRANSPATH: MO000087529.
DR EMBL: X55666;
DR UniProtKB: P22415-1;
XX
RN [1]; RE0000038.
RX PUBMED: 4075392.
RA Sawadogo M., Roeder R. G.
RT Interaction of a Gene-Specific Transcription Factor with the Adenovirus Major Late Promoter Upstream of the TATA Box Region
RL Cell 43:165-175 (1985).
RN [2]; RE0000040.
RX PUBMED: 4075400.
RA Carthew R. W., Chodosh L. A., Struhl P. A.
RT An RNA polymerase II transcription factor binds to an upstream element in the adenovirus major late promoter
RL Cell 43:439-448 (1985).
RN [3]; RE0000312.
RX PUBMED: 3023048.
RA Moncollin V., Miyamoto N. G., Zheng X. M., Egly J. M.
RT Identification of a factor specific for the upstream element of the adenovirus-2 major late promoter
RL EMBO J. 5:2577-2584 (1986).
RN [4]; RE0000314.
RX PUBMED: 2826128.
RA Lennard A. C., Egly J. M.
RT Thr bidirectional upstream element of the adenovirus-2 major late promoter binds a single monomeric molecule of the upstream factor
RL EMBO J. 6:3027-3034 (1987).
RN [5]; RE0000468.
RX PUBMED: 2323340.
RA Workman J. L., Roeder R. G., Kingston R. E.
RT An upstream transcription factor, USF (MLTF), facilitates the formation of preinitiation complexes during in vitro chromatin assembly
RL EMBO J. 9:1299-1308 (1990).
RN [6]; RE0000593.
RX PUBMED: 3192075.
RA Watt F., Molloy P. L.
RT Cytosine methylation prevents binding to DNA of a HeLa cell transcription factor required for optimal expression of the adenovirus major late promoter
RL Genes Dev. 2:1136-1143 (1988).
RN [7]; RE0000697.
RX PUBMED: 2249772.
RA Gregor P. D., Sawadogo M., Roeder R. G.
RT The adenovirus major late transcription factor USF is a member of the helix-loop-helix group of regulatory proteins and binds to DNA as a dimer
RL Genes Dev. 4:1730-1740 (1990).
RN [8]; RE0000701.
RX PUBMED: 2044953.
RA Beckmann H., Kadesch T.
RT The leucine zipper of TFE3 dictates helix-loop-helix dimerization specificity
RL Genes Dev. 5:1057-1066 (1991).
RN [9]; RE0000813.
RX PUBMED: 2708387.
RA Carcamo J., Lobos S., Merino A., Buckbinder L., Weinmann R., Natarajan V., Reinberg D.
RT Factors Involved in Specific Transcription by Mammalian RNA Polymerase II
RL J. Biol. Chem. 264:7704-7714 (1989).
RN [10]; RE0000876.
RX PUBMED: 3403558.
RA Sawadogo M., van Dyke M., Gregor P. D., Roeder R. G.
RT Multiple forms of the human gene-specific transcription factor USF. I. Complete purification and identification of USF from HeLa cell nuclei
RL J. Biol. Chem. 263:11985-11993 (1988).
RN [11]; RE0000877.
RX PUBMED: 3403559.
RA Sawadogo M.
RT Multiple forms of the human gene-specific transcription factor USF. II. DNA binding properties and transcriptional activity of the purified HeLa USF
RL J. Biol. Chem. 263:11994-12001 (1988).
RN [12]; RE0000927.
RX PUBMED: 1869565.
RA Potter J. J., Cheneval D., Dang C. V., Resar L. M. S., Mezey E., Yang V. W.
RT The upstream stimulatory factor binds to and activates the promoter of the rat class I alcohol dehydrogenase gene
RL J. Biol. Chem. 266:15457-15463 (1991).
RN [13]; RE0001191.
RX PUBMED: 1677811.
RA Zwartkruis F., Hoeijmakers T., Deschamps J., Meijlink F.
RT Characterization of the murine Hox-2.3 promoter: involvement of the transcription factor USF (MLTF)
RL Mech. Dev. 33:179-190 (1991).
RN [14]; RE0001210.
RX PUBMED: 2651905.
RA Chodosh L. A., Buratowski S., Sharp P. A.
RT A Yeast Protein Possesses the DNA-Binding Properties of the Adenovirus Major Late Transcription Factor
RL Mol. Cell. Biol. 9:820-822 (1989).
RN [15]; RE0001246.
RX PUBMED: 3043186.
RA Morgan J. G., Courtois G., Fourel G., Chodosh L. A., Campbell L., Evans E., Crabtree G. R.
RT Sp1, a CAAT-Binding Factor, and the Adenovirus Major Late Promoter Transcription Factor Interact with Functional Regions of the Gamma-Fibrinogen Promoter
RL Mol. Cell. Biol. 8:2628-2637 (1988).
RN [16]; RE0001359.
RX PUBMED: 3796614.
RA Chodosh L. A., Carthew R. W., Sharp P. A.
RT A single polypeptide possesses the binding and transcription activities of the adenovirus major late transcription factor
RL Mol. Cell. Biol. 6:4723-4733 (1986).
RN [17]; RE0001380.
RX PUBMED: 2779579.
RA Deng T., Li Y., Jolliff K., Johnson L. F.
RT The Mouse Thymidylate Synthase Promoter: Essential Elements Are in Close Proximity to the Transcriptional Initiation Sites
RL Mol. Cell. Biol. 9:4079-4082 (1989).
RN [18]; RE0001500.
RX PUBMED: 1986236.
RA Kaulen H., Pognonec P., Roeder R. G., Gregor P. D.
RT The xenopus B1 factor is closely related to the mammalian activator USF and is implicated in the developmental regulation of TFIIIA gene expression
RL Mol. Cell. Biol. 11:412-424 (1991).
RN [19]; RE0001685.
RX PUBMED: 1922036.
RA Pognonec P., Roeder R. G.
RT Recombinant 43-kDa USF binds to DNA and activates transcription in a manner indistinguishable from that of natural 43/44-kDa USF
RL Mol. Cell. Biol. 11:5125-5136 (1991).
RN [20]; RE0001862.
RX PUBMED: 1961251.
RA Roy A. L., Meisterernst M., Pognonec P., Roeder R. G.
RT Cooperative interaction of an initiator-binding transcription initiation factor and the helix-loop-helix activator USF
RL Nature 354:245-248 (1991).
RN [21]; RE0001954.
RX PUBMED: 3340547.
RA Nikolaev L. G., Glotov B. O., Belyavsky A. V., Grachev S. A., Levin A. V.
RT Identification of sequence-specific DNA-binding factors by label transfer: application to the adenovirus-2 major late promoter
RL Nucleic Acids Res. 16:519-535 (1988).
RN [22]; RE0002071.
RX PUBMED: 2204028.
RA Moncollin V., Stalder R., Verdier J.-M., Sentenac A., Egly J.-M.
RT A yeast homolog of the human UEF stimulates transcription from the adenovirus 2 major late promoter in yeast and in mammalian cell-free systems
RL Nucleic Acids Res. 18:4817-4823 (1990).
RN [23]; RE0002103.
RX PUBMED: 2831501.
RA Watt F., Molloy P. L.
RT High mobility group proteins 1 and 2 stimulate binding of a specific transcription factor to the adenovirus major late promoter
RL Nucleic Acids Res. 16:1471-1486 (1988).
RN [24]; RE0002165.
RX PUBMED: 2062639.
RA Mondesert G., Kedinger C.
RT Cooperation between upstream and downstream elements of the adenovirus major late promoter for maximal late phase-specific transcription
RL Nucleic Acids Res. 19:3221 (1991).
RN [25]; RE0002277.
RX PUBMED: 2951737.
RA Kovesdi I., Reichel R., Nevins J. R.
RT Role of an adenovirus E2 promoter binding factor in E1A-mediated coordinate gene control
RL Proc. Natl. Acad. Sci. USA 84:2180-2184 (1987).
RN [26]; RE0002362.
RX PUBMED: 3474628.
RA Hough P. V. C., Mastrangelo I. A., Wall J. S., Hainfeld J. F., Sawadogo M., Roeder R. G.
RT The gene-specific initiation factor USF (upstream stimulatory factor) bound at the adenovirus type 2 major late promoter: Mass and three-dimensional structure
RL Proc. Natl. Acad. Sci. USA 84:4826-4830 (1987).
RN [27]; RE0002420.
RX PUBMED: 1731330.
RA Dang C. V., Dolde C., Gillison M. L., Kato G. J.
RT Discrimination between related DNA sites by a single amino acid residue of Myc-related basic-helix-loop-helix proteins
RL Proc. Natl. Acad. Sci. USA 89:599-602 (1992).
RN [28]; RE0002588.
RX PUBMED: 3672119.
RA Chodosh L. A., Carthew R. W., Morgan J. G., Crabtree G. R., Sharp P. A.
RT The Adenovirus Major Late Transcription Factor Activates the Rat gamma-Fibrinogen Promoter
RL Science 238:684-688 (1987).
RN [29]; RE0002756.
RX PUBMED: 2192257.
RA van Dyke M. W., Sawadogo M.
RT DNA-binding and transcriptional properties of human transcription factor TFIID after mild proteolysis
RL Mol. Cell. Biol. 10:3415-3420 (1990).
RN [30]; RE0002940.
RX PUBMED: 1406684.
RA Kirschbaum B. J., Pognonec P., Roeder R. G.
RT Definition of the transcriptional activation domain of recombinant 43-kilodalton USF
RL Mol. Cell. Biol. 12:5094-5101 (1992).
RN [31]; RE0003338.
RX PUBMED: 1465398.
RA Fisher D. E., Parent L. A., Sharp P. A.
RT Myc/Max and other helix-loop-helix/leucine zipper proteins bend DNA toward the minor groove
RL Proc. Natl. Acad. Sci. USA 89:11779-11783 (1992).
RN [32]; RE0003394.
RX PUBMED: 8306960.
RA Ferre-D'Amare A. R., Pognonec P., Roeder R. G., Burley S. K.
RT Structure and function of the b/HLH/Z domain of USF
RL EMBO J. 13:180-189 (1994).
RN [33]; RE0003426.
RX PUBMED: 1447201.
RA Pognonec P., Kato H., Roeder R. G.
RT The helix-loop-helix/leucine repeat transcription factor USF can be functionally regulated in a redox-dependent manner
RL J. Biol. Chem. 267:24563-24567 (1992).
RN [34]; RE0003427.
RX PUBMED: 8127680.
RA Sirito M., Lin Q., Maity T., Sawadogo M.
RT Ubiquitous expression of the 43- and 44-kDa forms of transcription factor USF in mammalian cells
RL Nucleic Acids Res. 22:427-433 (1994).
RN [35]; RE0006753.
RX PUBMED: 8576131.
RA Viollet B., Lefrancois-Martinez A. M., Henrion A., Kahn A., Raymondjean M., Martinez A.
RT Immunochemical characterization and transacting properties of upstream stimulatory factor isoforms
RL J. Biol. Chem. 271:1405-1415 (1996).
RN [36]; RE0010283.
RX PUBMED: 7862113.
RA Timchenko N., Wilson D. R., Taylor L. R., Abdelsayed S., Wilde M., Sawadogo M., Darlington G. J.
RT Autoregulation of the human C/EBPalpha gene by stimulation of upstream stimulatory factor binding
RL Mol. Cell. Biol. 15:1192-1202 (1995).
RN [37]; RE0016864.
RX PUBMED: 10770922.
RA Carreira S., Liu B., Goding C. R.
RT The gene encoding the T-box factor Tbx2 is a target for the microphthalmia-associated transcription factor in melanocytes
RL J. Biol. Chem. 275:21920-21927 (2000).
RN [38]; RE0048300.
RX PUBMED: 16225938.
RA Payton S. G., Liu M., Ge Y., Matherly L. H.
RT Transcriptional regulation of the human reduced folate carrier A1/A2 promoter: Identification of critical roles for the USF and GATA families of transcription factors.
RL Biochim. Biophys. Acta 1731:115-124 (2005).
RN [39]; RE0065107.
RX PUBMED: 18845576.
RA Kajiwara M., Terada T., Asaka J., Aoki M., Katsura T., Ikai I., Inui K.
RT Regulation of basal core promoter activity of human organic cation transporter 1 (OCT1/SLC22A1).
RL Am. J. Physiol. Gastrointest. Liver Physiol. 295:G1211-6 (2008).
XX
//