TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10006 XX ID T10006 XX DT 11.12.2006 (created); kau. DT 11.10.2010 (updated); jig. CO Copyright (C), QIAGEN. XX FA Myf-5 XX SY Myf-5. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003932 MYF5; HGNC: MYF5. XX CL C0010; bHLH. XX SZ 255 AA; 28.4 kDa (cDNA) (calc.). XX SQ MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTG SQ HHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK SQ VEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSS SQ TFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQP SQ RTPGASSSRLIYHVL XX SC Swiss-Prot#P13349 XX FT 1 83 PF01586; Myogenic Basic domain. FT 1 88 SM00520; BASIC. FT 83 135 PS50888; HLH. FT 84 135 PF00010; Helix-loop-helix DNA-binding domain. FT 89 140 SM00353; finulus. XX IN T00403 Id1; mouse, Mus musculus. IN T10004 Id2; mouse, Mus musculus. XX MX M00973 V$E2A_Q6. MX M01034 V$EBOX_Q6_01. MX M03880 V$MYF5_Q6. XX BS R02418. BS R02419. XX DR TRANSPATH: MO000094579. DR EMBL: X14894; DR UniProtKB: P13349; XX RN [1]; RE0000475. RX PUBMED: 2583111. RA Braun T., Bober E., Buschhausen-Denker G., Kotz S., Grzeschik K., Arnold H. H. RT Differential expression of myogenic determination genes in muscle cells: possible autoactivation by the Myf gene products RL EMBO J. 8:3617-3625 (1989). RN [2]; RE0000476. RX PUBMED: 2721498. RA Braun T., Buschhausen-Denker G., Bober E., Tannich E., Arnold H. H. RT A novel human muscle factor related to but distinct from MyoD1 induces myogenic conversion in 10T1/2 fibroblasts RL EMBO J. 8:701-709 (1989). RN [3]; RE0001863. RX PUBMED: 2385294. RA Braun T., Winter B., Bober E., Arnold H. H. RT Transcriptional activation domain of the muscle-specific gene-regulatory protein myf5 RL Nature 346:663-665 (1990). RN [4]; RE0002108. RX PUBMED: 1945842. RA Braun T., Arnold H. H. RT The four helix-loop-helix proteins Myf3-Myf6 exhibit similar hetero-dimerization and DNA binding properties RL Nucleic Acids Res. 19:5645-5651 (1991). RN [5]; RE0003234. RX PUBMED: 8387507. RA Winter B., Braun T., Arnold H. H. RT cAMP-dependent protein kinase represses myogenic differentiation and the activity of the muscle-specific helix-loop-helix transcription factors Myf-5 and MyoD RL J. Biol. Chem. 13:9869-9878 (1993). RN [6]; RE0003260. RX PUBMED: 1315706. RA Braun T., Bober E., Arnold H. H. RT Inhibition of muscle differentiation by the adenovirus E1a protein: Repression of the transcriptional activating function of the HLH protein Myf-5 RL Genes Dev. 6:888-902 (1992). RN [7]; RE0003261. RX PUBMED: 1582413. RA Winter B., Braun T., Arnold H.-H. RT Co-operativity of functional domains in the muscle-specific transcription factor Myf-5 RL EMBO J. 11:1843-1855 (1992). RN [8]; RE0048980. RX PUBMED: 9242638. RA Langlands K., Yin X., Anand G., Prochownik E. V. RT Differential interactions of Id proteins with basic-helix-loop-helix transcription factors. RL J. Biol. Chem. 272:19785-19793 (1997). RN [9]; RE0067513. RX PUBMED: 16980408. RA Wu Z., Huang X., Feng Y., Handschin C., Feng Y., Gullicksen P. S., Bare O., Labow M., Spiegelman B., Stevenson S. C. RT Transducer of regulated CREB-binding proteins (TORCs) induce PGC-1alpha transcription and mitochondrial biogenesis in muscle cells. RL Proc. Natl. Acad. Sci. USA 103:14379-14384 (2006). XX //