AC T10068
XX
ID T10068
XX
DT 04.01.2007 (created); sts.
DT 29.12.2010 (updated); pro.
CO Copyright (C), QIAGEN.
XX
FA COUP-TF2
XX
SY apolipoprotein AI regulatory protein; Apolipoprotein Repressor Protein 1; ARP-1; COUP-beta; COUP-TF II; NR2F2.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004656 NR2F2; HGNC: NR2F2.
XX
CL C0002; CC (rec).
XX
SZ 414 AA; 45.6 kDa (cDNA) (calc.).
XX
SQ MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
SQ GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
SQ CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
SQ YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
SQ QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
SQ KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
SQ GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
XX
SC Swiss-Prot#P24468
XX
FT 76 147 SM00399; c4gold.
FT 76 151 PS51030; NUCLEAR_REC_DBD_2.
FT 77 152 PF00105; Zinc finger, C4 type (two domains).
FT 214 374 SM00430; holi.
FT 217 399 PF00104; Ligand-binding domain of nuclear hormon.
XX
SF The DBD, carboxy terminus and the integrity of the ninth heptad repeat are required for the repressor activity of this molecule [15];
XX
IN T27831 BCL-11A; mouse, Mus musculus.
XX
MX M00155 V$ARP1_01.
MX M00765 V$COUPDR1_Q6.
MX M03543 V$COUPTF2_Q6.
MX M01036 V$COUPTF_Q6.
MX M00762 V$DR1_Q3.
MX M00965 V$DR4_Q2.
MX M00967 V$HNF4_Q6.
MX M07280 V$NR1NR2_Q3.
XX
BS R03989.
BS R04590.
BS R04403.
BS R04405.
BS R01465.
BS R04404.
BS R33846.
BS R08505.
BS R02960.
BS R20990.
BS R16065.
BS R20992.
BS R02657.
BS R13058.
BS R33056.
BS R01859.
BS R16621.
BS R16624.
BS R12990.
BS R08504.
BS R08506.
BS R26534.
BS R17087.
BS R04768.
BS R04770.
BS R22493.
BS R22495.
BS R22488.
BS R22490.
BS R22491.
BS R09968.
BS R13073.
BS R08877.
XX
DR TRANSPATH: MO000095603.
DR EMBL: M64497;
DR UniProtKB: P24468;
XX
RN [1]; RE0002714.
RX PUBMED: 1899293.
RA Ladias J. A. A., Karathanasis S. K.
RT Regulation of the apolipoprotein A1 gene by ARP-1, a novel member of the steroid receptor superfamily
RL Science 251:561-565 (1991).
RN [2]; RE0002994.
RX PUBMED: 1328857.
RA Tran P., Zhang X.-K., Salbert G., Hermann T., Lehmann J. M., Pfahl M.
RT COUP orphan receptors are negative regulators of retinoic acid response pathways
RL Mol. Cell. Biol. 12:4666-4676 (1992).
RN [3]; RE0003068.
RX PUBMED: 1321332.
RA Widom R. L., Rhee M., Karathanasis S. K.
RT Repression by ARP-1 sensitizes apolipoprotein AI gene responsiveness to RXRalpha and retinoic acid
RL Mol. Cell. Biol. 12:3380-3389 (1992).
RN [4]; RE0003072.
RX PUBMED: 1312668.
RA Mietus-Snyder M., Sladek F. M., Ginsburg G. S., Kuo C. F., Ladias J. A. A., Darnell jr J. E., Karathanasis S. K.
RT Antagonism between apolipoprotein AI regulatory protein 1, Ear3/COUP-TF, and hepatocyte nuclear factor 4 modulates apolipoprotein CIII gene expression in liver and intestinal cells
RL Mol. Cell. Biol. 12:1708-1718 (1992).
RN [5]; RE0010425.
RX PUBMED: 7753622.
RA Muscat G. E. O., Rea S., Downes M.
RT Identification of a regulatory function for an orphan receptor in muscle: COUP-TF II affects the expression of the myoD gene family during myogenesis
RL Nucleic Acids Res. 23:1311-1318 (1995).
RN [6]; RE0010509.
RX PUBMED: 7891708.
RA Galson D. L., Tsuchiya T., Tendler D. S., Huang L. E., Ren Y., Ogura T., Bunn H. F.
RT The orphan receptor hepatic nuclear factor 4 functions as a transcriptional activator for tissue-specific and hypoxia-specific erythropoietin gene expression and is antagonized by EAR3/COUP-TF1
RL Mol. Cell. Biol. 15:2135-2144 (1995).
RN [7]; RE0013625.
RX PUBMED: 10219237.
RA Nuclear Receptors Nomenclature Committee.
RT A unified nomenclature system for the nuclear receptor superfamily
RL Cell 97:161-163 (1999).
RN [8]; RE0014411.
RX PUBMED: 8505324.
RA Rottman J. N., Gordon J. I.
RT Comparison of the patterns of expression of rat intestinal fatty acid binding protein/human growth hormone fusion genes in cultured intestinal epithelial cell lines and in the gut epithelium of transgenic mice
RL J. Biol. Chem. 268:11994-12002 (1993).
RN [9]; RE0016808.
RX PUBMED: 9461615.
RA Vorgia P., Zannis V. I., Kardassis D.
RT A short proximal promoter and the distal hepatic control region-1 (HCR-1) contribute to the liver specificity of the human apolipoprotein C-II gene. Hepatic enhancement by HCR-1 requires two proximal hormone response elements which have different binding specificities for orphan receptors HNF-4, ARP-1, and EAR-2.
RL J. Biol. Chem. 273:4188-4196 (1998).
RN [10]; RE0016834.
RX PUBMED: 11085951.
RA McNair A., Cereghini S., Brand H., Smith T., Breillat C., Gannon F.
RT Synergistic activation of the Atlantic salmon hepatocyte nuclear factor (HNF) 1 promoter by the orphan nuclear receptors HNF4 and chicken ovalbumin upstream promoter transcription factor I (COUP-TFI).
RL Biochem. J. 352:557-564 (2000).
RN [11]; RE0016841.
RX PUBMED: 10627496.
RA Stroup D., Chiang J. Y.
RT HNF4 and COUP-TFII interact to modulate transcription of the cholesterol 7alpha-hydroxylase gene (CYP7A1).
RL J. Lipid Res. 41:1-11 (2000).
RN [12]; RE0018030.
RX PUBMED: 10098492.
RA Robinson C. E., Wu X., Nawaz Z., Onate S. A., Gimble J. M.
RT A corepressor and chicken ovalbumin upstream promoter transcriptional factor proteins modulate peroxisome proliferator-activated receptor-gamma2/retinoid X receptor alpha-activated transcription from the murine lipoprotein lipase promoter.
RL Endocrinology 140:1586-1593 (1999).
RN [13]; RE0035108.
RX PUBMED: 11544252.
RA Liberati C., Cera M. R., Secco P., Santoro C., Mantovani R., Ottolenghi S., Ronchi A.
RT Cooperation and competition between the binding of COUP-TFII and NF-Y on human epsilon- and gamma-globin gene promoters.
RL J. Biol. Chem. 276:41700-41709 (2001).
RN [14]; RE0035110.
RX PUBMED: 9927428.
RA Filipe A., Li Q., Deveaux S., Godin I., Romeo P. H., Stamatoyannopoulos G., Mignotte V.
RT Regulation of embryonic/fetal globin genes by nuclear hormone receptors: a novel perspective on hemoglobin switching.
RL EMBO J. 18:687-697 (1999).
RN [15]; RE0049768.
RX PUBMED: 9271371.
RA Achatz G., Holzl B., Speckmayer R., Hauser C., Sandhofer F., Paulweber B.
RT Functional domains of the human orphan receptor ARP-1/COUP-TFII involved in active repression and transrepression.
RL Mol. Cell. Biol. 17:4914-4932 (1997).
RN [16]; RE0052267.
RX PUBMED: 10744719.
RA Avram D., Fields A., Pretty On Top K., Nevrivy D. J., Ishmael J. E., Leid M.
RT Isolation of a novel family of C(2)H(2) zinc finger proteins implicated in transcriptional repression mediated by chicken ovalbumin upstream promoter transcription factor (COUP-TF) orphan nuclear receptors.
RL J. Biol. Chem. 275:10315-10322 (2000).
XX
//