TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10083 XX ID T10083 XX DT 05.01.2007 (created); ask. DT 06.07.2015 (updated); pro. CO Copyright (C), QIAGEN. XX FA HNF-3alpha XX SY FOXA1; Hepatocyte Nuclear Factor 3 alpha; HNF-3A; HNF-3alpha; HNF-5; HNF3. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G013745 Foxa1. XX CL C0023; fork head. XX SZ 466 AA; 48.8 kDa (cDNA) (calc.), 50 kDa (SDS) XX SQ MLGTVKMEGHESNDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMT SQ PASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGAALSPGGMGSMGAQP SQ AASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLIT SQ MAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNACFVKVARSPDKPGK SQ GSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGSGGGGSKGVPENRKDPSGPVNPS SQ AESPIHRGVHGKASQLEGAPAPGPAASPQTLDHSGATATGGGSELKSPASSSAPPISSGP SQ GGWICTPLSPTWLAPHESQLHLKGAPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQY SQ SPYGATLPASLPLGGASVATRSPIEPSALEPAYYQGVYSRPVLNTS XX SC Swiss-Prot#P23512 XX FT 168 267 fork head domain [11]. FT 168 258 SM00339; forkneu4. FT 170 264 PS50039; FORK_HEAD_3. FT 170 265 PF00250; Fork head domain. XX IN T08473 AR; mouse, Mus musculus. XX MX M00724 V$HNF3ALPHA_Q6. MX M01261 V$HNF3A_01. MX M03827 V$HNF3A_Q6. MX M00791 V$HNF3_Q6. MX M01012 V$HNF3_Q6_01. XX BS R08890. BS R05086. BS R13062. BS R13061. BS R05076. BS R68653. BS R01464. BS R26428. BS R26429. BS R26417. BS R26419. BS R26420. BS R26421. BS R26430. BS R26431. BS R04662. BS R05017. BS R05019. BS R05029. BS R08894. BS R02895. XX DR TRANSPATH: MO000095670. DR EMBL: X55955; DR UniProtKB: P23512; XX RN [1]; RE0000254. RX PUBMED: 2225060. RA Weigel D., Jaeckle H. RT The fork head domain: a novel DNA binding motif of eukaryotic transcription factors? RL Cell 63:455-456 (1990). RN [2]; RE0000288. RX PUBMED: 1638120. RA Sladek F. M., Darnell J. E. RT Mechanisms of liver-specific gene expression RL Curr. Opin. Gen. Dev. 2:256-259 (1992). RN [3]; RE0000676. RX PUBMED: 2227418. RA Lai E., Prezioso V. R., Smith E., Litvin O., Costa R. H., Darnell J. E. RT HNF-3A, a hepatocyte-enriched transcription factor of novel structure is regulated transcriptionally RL Genes Dev. 4:1427-1436 (1990). RN [4]; RE0000677. RX PUBMED: 1672118. RA Lai E., Prezioso V. R., Tao W., Chen W. S., Darnell J. E. RT Hepatocyte nuclear factor 3alpha belongs to a gene family in mammals that is homologous to the Drosophila homeotic gene fork head RL Genes Dev. 5:416-427 (1991). RN [5]; RE0002090. RX PUBMED: 1672737. RA Grange T., Roux J., Rigaud G., Pictet R. RT Cell-type specific activity of two glucocorticoid responsive units of rat tyrosine aminotransferase gene is associated with multiple binding sites for C/EBP and a novel liver-specific nuclear factor RL Nucleic Acids Res. 19:131-139 (1991). RN [6]; RE0002265. RX PUBMED: 2922398. RA Herbst R. S., Friedman N., Darnell J. E., Babiss L. E. RT Positive and negative regulatory elements in the mouse albumin enhancer RL Proc. Natl. Acad. Sci. USA 86:1553-1557 (1989). RN [7]; RE0002542. RX PUBMED: 1909027. RA Li C., Lai C., Sigman D. S., Gaynor R. B. RT Cloning of a cellular factor, interleukin binding factor, that binds to NFAT-like motifs in the human immunodeficiency virus long terminal repeat RL Proc. Natl. Acad. Sci. USA 88:7739-7743 (1991). RN [8]; RE0006510. RX PUBMED: 8165139. RA Gregori C., Kahn A., Pichard A. L. RT Activity of the rat liver-specific aldolase B promoter is restrained by HNF3 RL Nucleic Acids Res. 22:1242-1246 (1994). RN [9]; RE0006511. RX PUBMED: 8383844. RA Gregori C., Kahn A., Pichard A. L. RT Competition between transcription factors HNF1 nnd HNF3, and alternative cell-specific activation by DBP and C/EBP contribute to the regulation of the liver-specific aldolase B promoter RL Nucleic Acids Res. 21:897- 903 (1993). RN [10]; RE0006537. RX PUBMED: 8029022. RA Jacob A., Budhiraja S., Qian X., Clevidence D. E., Costa R. H., Reichel R. R. RT Retinoic acid-mediated activation of HNF-3alpha during EC stem cell differentiation RL Nucleic Acids Res. 22:2126-2133 (1994). RN [11]; RE0006655. RA TRANSFAC_Team. RT Revisions of transcription factor domains RL TRANSFAC Reports 1:0002 (1998). RN [12]; RE0014431. RX PUBMED: 9832435. RA Dean D. M., Berger R. R., Sanders M. M. RT A winged-helix family member is involved in a steroid hormone-triggered regulatory circuit RL Endocrinology 139:4967-4975 (1998). RN [13]; RE0016757. RX PUBMED: 8993836. RA Peterson R. S., Clevidence D. E., Ye H., Costa R. H. RT Hepatocyte nuclear factor-3 alpha promoter regulation involves recognition by cell-specific factors, thyroid transcription factor-1, and autoactivation. RL Cell Growth Differ. 8:69-82 (1997). RN [14]; RE0051642. RX PUBMED: 18178153. RA Lee H. J., Hwang M., Chattopadhyay S., Choi H. S., Lee K. RT Hepatocyte nuclear factor-3 alpha (HNF-3alpha) negatively regulates androgen receptor transactivation in prostate cancer cells. RL Biochem. Biophys. Res. Commun. 367:481-486 (2008). XX //