TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10133 XX ID T10133 XX DT 11.01.2007 (created); sou. DT 17.01.2007 (updated); sou. CO Copyright (C), QIAGEN. XX FA CLIM2-isoform1 XX SY carboxy terminal LIM domain protein 2; Ldb1; LIM domain binding protein 1; NLI. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006357 Ldb1. XX SZ 375 AA; 42.7 kDa (cDNA) (calc.). XX SQ MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTE SQ FFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVS SQ LDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMH SQ AQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTCSLSPRDCLKTCLFQ SQ KWQRMVAPPAEPARQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQAPD SQ VMVVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDEDSFNNSPALGANSQRNSKPPS SQ SQESKSENPTSQASQ XX SC translated from EMBL #U89488 XX FT 1 375 PF01803; LIM-domain binding protein. XX IN T01799 Tal-1; mouse, Mus musculus. XX DR TRANSPATH: MO000096085. DR EMBL: U69270; DR EMBL: U70375; DR EMBL: U89488; DR UniProtKB: P70662; XX RN [1]; RE0006080. RX PUBMED: 8876198. RA Jurata L. W., Kenny D. A., Gill G. N. RT Nuclear LIM interactor, a rhombotin and LIM homeodomain interacting protein, is expressed early in neuronal development RL Proc. Natl. Acad. Sci. USA 93:11693-11698 (1996). RN [2]; RE0006081. RX PUBMED: 8918878. RA Agulnick A. D., Taira M., Breen J. J., Tanaka T., Dawid I. B., Westphal H. RT Interactions of the LIM-domain-binding factor Ldb1 with LIM homeodomain proteins RL Nature 384:270-272 (1996). RN [3]; RE0013512. RX PUBMED: 9192866. RA Bach I., Carriere C., Ostendorff H. P., Andersen B., Rosenfeld M. G. RT A family of LIM domain-associated cofactors confer transcriptional synergism between LIM and Otx homeodomain proteins. RL Genes Dev. 11:1370-1380 (1997). RN [4]; RE0015585. RX PUBMED: 10393337. RA Kimura N., Ueno M., Nakashima K., Taga T. RT A brain region-specific gene product Lhx6.1 interacts with Ldb1 through tandem LIM-domains RL J. Biochem. 126:180-187 (1999). RN [5]; RE0015590. RX PUBMED: 9880598. RA Retaux S., Rogard M., Bach I., Failli V., Besson M. J. RT Lhx9: a novel LIM-homeodomain gene expressed in the developing forebrain RL J. Neurosci. 19:783-793 (1999). RN [6]; RE0015591. RX PUBMED: 10330499. RA Bertuzzi S., Porter F. D., Pitts A., Kumar M., Agulnick A., Wassif C., Westphal H. RT Characterization of Lhx9, a novel LIM/homeobox gene expressed by the pioneer neurons in the mouse cerebral cortex RL Mech. Dev. 81:193-198 (1999). RN [7]; RE0049178. RX PUBMED: 15314159. RA Schlaeger T. M., Schuh A., Flitter S., Fisher A., Mikkola H., Orkin S. H., Vyas P., Porcher C. RT Decoding hematopoietic specificity in the helix-loop-helix domain of the transcription factor SCL/Tal-1. RL Mol. Cell. Biol. 24:7491-7502 (2004). XX //