TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10282 XX ID T10282 XX DT 01.03.2007 (created); ask. DT 27.09.2011 (updated); hna. CO Copyright (C), QIAGEN. XX FA Otx2 XX SY orthodenticle related homeobox protein 2. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004500 Otx2. XX CL C0006; homeo; 3.1.3.17.2.1. XX SZ 289 AA; 31.6 kDa (cDNA) (calc.). XX SQ MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKT SQ RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKSSPARE SQ VSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYT SQ QASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLST SQ QGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL XX SC Swiss-Prot#P80206 XX FT 36 96 PS50071; HOMEOBOX_2. FT 38 94 PS50552; PAX. FT 38 100 SM00389; HOX_1. FT 39 95 PF00046; Homeobox domain. FT 153 235 PF03529; Otx1 transcription factor. XX IN T09219 Grg4; mouse, Mus musculus. XX MX M08892 V$CRX_Q6. MX M01387 V$OTX2_01. MX M01719 V$OTX2_Q3. MX M04623 V$OTX2_Q3_01. MX M01117 V$OTX_Q1. XX BS R15733. BS R36675. BS R36740. BS R36741. BS R30060. BS R15750. BS R15751. BS R30158. BS R30161. BS R30164. BS R30167. BS R30153. BS R30156. BS R35869. BS R16820. BS R20636. BS R73346. BS R15752. BS R15753. BS R15754. BS R15755. BS R15756. BS R15759. BS R16176. BS R04992. XX DR TRANSPATH: MO000101723. DR UniProtKB: P80206; XX RN [1]; RE0005031. RX PUBMED: 1353865. RA Simeone A., Acampora D., Gulisano M., Stornaiuolo A., Rambaldi M., Boncinelli E. RT Nested expression domains of four homeobox genes in developing rostral brain RL Nature 358:687-690 (1992). RN [2]; RE0005172. RX PUBMED: 8101484. RA Simeone A., Acampora D., Mallamaci A., Stornaiuolo A., D'Apice M. R., Nigro V., Boncinelli E. RT A vertebrate gene related to orthodenticle contains a homeodomain of the bicoid class and demarcates anterior neuroectoderm in the gastrulating mouse embryo RL EMBO J. 12:2735-2747 (1993). RN [3]; RE0015734. RX PUBMED: 9371841. RA Smidt M. P., van Schaick H. S., Lanctot C., Tremblay J. J., Cox J. J., van der Kleij A. A., Wolterink G., Drouin J., Burbach J. P. RT A homeodomain gene Ptx3 has highly restricted brain expression in mesencephalic dopaminergic neurons RL Proc. Natl. Acad. Sci. USA 94:13305-13310 (1997). RN [4]; RE0024916. RX PUBMED: 12055180. RA Zhang Y., Miki T., Iwanaga T., Koseki Y., Okuno M., Sunaga Y., Ozaki N., Yano H., Koseki H., Seino S. RT Identification, tissue expression, and functional characterization of Otx3, a novel member of the Otx family. RL J. Biol. Chem. 277:28065-28069 (2002). RN [5]; RE0054218. RX PUBMED: 17060451. RA Heimbucher T., Murko C., Bajoghli B., Aghaallaei N., Huber A., Stebegg R., Eberhard D., Fink M., Simeone A., Czerny T. RT Gbx2 and Otx2 interact with the WD40 domain of Groucho/Tle corepressors. RL Mol. Cell. Biol. 27:340-351 (2007). RN [6]; RE0066993. RX PUBMED: 19843539. RA Reichman S., Kalathur R. K., Lambard S., Ait-Ali N., Yang Y., Lardenois A., Ripp R., Poch O., Zack D. J., Sahel J. A., Leveillard T. RT The homeobox gene CHX10/VSX2 regulates RdCVF promoter activity in the inner retina. RL Hum. Mol. Genet. 19:250-261 (2010). XX //