TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10289 XX ID T10289 XX DT 05.03.2007 (created); sri. DT 07.03.2007 (updated); sri. CO Copyright (C), QIAGEN. XX FA MITF-M1 XX SY Mi; Microphthalmia; microphthalmia-associated transcription factor. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002681 MITF; HGNC: MITF. XX CL C0012; bHLH-ZIP; 1.2.6.1.4.9. XX SZ 419 AA; 46.9 kDa (cDNA) (calc.). XX SQ MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDH SQ VMPPVPGSSAPNSPMAMLTLNSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVI SQ DDIISLESSYNEEILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPN SQ IKRELTACIFPTESEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMR SQ WNKGTILKASVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLI SQ PSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEA SQ NQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC XX SC translated from EMBL #Z29678 XX FT 3 295 PF00478; IMP dehydrogenase / GMP reductase domain. FT 202 258 PS50888; HLH. FT 205 258 PF00010; Helix-loop-helix DNA-binding domain. FT 210 263 SM00353; finulus. XX IN T10291 TFEA-isoform1; human, Homo sapiens. IN T10290 tfeb; human, Homo sapiens. XX MX M01034 V$EBOX_Q6_01. MX M07050 V$MITF_Q4. MX M02099 V$MITF_Q6. MX M01029 V$TFE_Q6. XX BS R15441. BS R15430. BS R15438. BS R15440. XX DR TRANSPATH: MO000101985. DR EMBL: Z29678; DR UniProtKB: O75030-9; XX RN [1]; RE0003425. RX PUBMED: 8069297. RA Tachibana M., Perez-Jurado L. A., Nakayama A., Hodgkinson C. A., Li X., Schneider M., Miki T., Fex J., Francke U., Arnheiter H. RT Cloning of MITF, the human homolog of the mouse microphthalmia gene, and assignment to human chromosome 3, region p14.1-p12.3 RL Hum. Mol. Genet. 3:553-557 (1994). RN [2]; RE0024401. RX PUBMED: 8995290. RA Yasumoto K., Yokoyama K., Takahashi K., Tomita Y., Shibahara S. RT Functional analysis of microphthalmia-associated transcription factor in pigment cell-specific transcription of the human tyrosinase family genes. RL J. Biol. Chem. 272:503-509 (1997). RN [3]; RE0024474. RX PUBMED: 12048204. RA Saito H., Yasumoto K., Takeda K., Takahashi K., Fukuzaki A., Orikasa S., Shibahara S. RT Melanocyte-specific microphthalmia-associated transcription factor isoform activates its own gene promoter through physical interaction with lymphoid-enhancing factor 1. RL J. Biol. Chem. 277:28787-28794 (2002). RN [4]; RE0024619. RX PUBMED: 10747853. RA Takeda K., Yasumoto K., Takada R., Takada S., Watanabe K., Udono T., Saito H., Takahashi K., Shibahara S. RT Induction of melanocyte-specific microphthalmia-associated transcription factor by Wnt-3a. RL J. Biol. Chem. 275:14013-14016 (2000). RN [5]; RE0049462. RX PUBMED: 15507434. RA Miller A. J., Levy C., Davis I. J., Razin E., Fisher D. E. RT Sumoylation of MITF and its related family members TFE3 and TFEB. RL J. Biol. Chem. 280:146-155 (2005). XX //