AC T10428
XX
ID T10428
XX
DT 25.04.2007 (created); apk.
DT 04.08.2014 (updated); spk.
CO Copyright (C), QIAGEN.
XX
FA YY1
XX
SY CF1; common factor 1; delta-factor; F-ACT1; myc-CF1; NF-E1 (2); UCRBP; UCRF-U; upstream conserved region binding protein; Ying Yang 1; YY-1; YY1.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G009132 Yy1.
XX
CL C0001; CH.
XX
SZ 414 AA; 44.7 kDa (cDNA) (calc.), 60-65 kDa (SDS)
XX
SQ MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHG
SQ GGGGGHGHAGHHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDS
SQ DGLRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGASSGGGRVKKGGGKKS
SQ GKKSYLGGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEE
SQ QIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
SQ KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGC
SQ GKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
XX
SC Swiss-Prot#Q00899
XX
FT 15 293 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 170 200 
interaction with HDAC2 [9].
FT 170 200 
repression domain [9].
FT 296 320 
PF00096; zf-C2H2.
FT 296 320 
PS50157; ZINC_FINGER_C2H2_2.
FT 296 320 
SM00355; c2h2final6.
FT 325 347 
PF00096; zf-C2H2.
FT 325 347 
SM00355; c2h2final6.
FT 325 352 
PS50157; ZINC_FINGER_C2H2_2.
FT 353 377 
PF00096; zf-C2H2.
FT 353 377 SM00355; c2h2final6.
FT 353 382 PS50157; ZINC_FINGER_C2H2_2.
FT 383 407 PF00096; zf-C2H2.
FT 383 407 SM00355; c2h2final6.
FT 383 412 PS50157; ZINC_FINGER_C2H2_2.
XX
IN T01556 SREBP-1a; human, Homo sapiens.
XX
MX M00059 V$YY1_01.
MX M00069 V$YY1_02.
MX M02044 V$YY1_03.
MX M07370 V$YY1_Q4_01.
MX M00793 V$YY1_Q6.
MX M01035 V$YY1_Q6_02.
MX M01894 V$YY1_Q6_03.
XX
BS R36067.
BS R36072.
BS R36073.
BS R36074.
BS R36075.
BS R36076.
BS R36077.
BS R36078.
BS R36079.
BS R36080.
BS R36081.
BS R36082.
BS R36083.
BS R36084.
BS R36085.
BS R36086.
BS R36087.
BS R36088.
BS R36089.
BS R36090.
BS R36091.
BS R36092.
BS R36093.
BS R36094.
BS R36095.
BS R36096.
BS R36097.
BS R36098.
BS R36099.
BS R36100.
BS R36101.
BS R36102.
BS R36103.
BS R36104.
BS R36105.
BS R36106.
BS R36107.
BS R36108.
BS R36109.
BS R36110.
BS R11726.
BS R26251.
BS R27111.
BS R27101.
BS R61295.
BS R01833.
BS R33657.
BS R01149.
BS R04898.
BS R04899.
XX
DR TRANSPATH: MO000105093.
DR EMBL: M74590;
DR UniProtKB: Q00899;
XX
RN [1]; RE0000624.
RX PUBMED: 2606348.
RA Hariharan N., Kelley D. E., Perry R. P.
RT Equipotent mouse ribosomal protein promoters have a similar architecture that includes internal sequence elements
RL Genes Dev. 3:1789-1800 (1989).
RN [2]; RE0001317.
RX PUBMED: 2540425.
RA Flanagan J. R., Krieg A. M., Max E. E., Khan A. S.
RT Negative Control Region at the 5' End of Murine Leukemia Virus Long Terminal Repeats
RL Mol. Cell. Biol. 9:739-746 (1989).
RN [3]; RE0001335.
RX PUBMED: 2546059.
RA Atchison M. L., Meyuhas O., Perry R. P.
RT Localization of Transcriptional Regulatory Elements and Nuclear Factor Binding Sites in Mouse Ribosomal Protein Gene rpL32
RL Mol. Cell. Biol. 9:2067-2074 (1989).
RN [4]; RE0001593.
RX PUBMED: 1899910.
RA Riggs K. J., Merrell K. T., Wilson G., Calame K.
RT Common factor 1 is a transcriptional activator which binds in the c.myc promoter, the skeletal alpha-actin promoter, and the immunoglobulin heavy-chain enhancer
RL Mol. Cell. Biol. 11:1765-1769 (1991).
RN [5]; RE0001850.
RX PUBMED: 2662014.
RA Kakkis E., Riggs K. J., Gillespie W., Calame K.
RT A transcriptional repressor of c-myc
RL Nature 339:718-721 (1989).
RN [6]; RE0002849.
RX PUBMED: 1946404.
RA Hariharan N., Kelly D. E., Perry R. P.
RT Delta, a transcription factor that binds to downstream elements in several polymerase II promoters, is a functionally versatile zinc finger protein
RL Proc. Natl. Acad. Sci. USA 88:9799-9803 (1991).
RN [7]; RE0002850.
RX PUBMED: 1946405.
RA Park K., Atchison M. L.
RT Isolation of a candidate repressor/activator, NF-E1 (YY-1, delta), that binds to the immunoglobulin kappa 3 enhancer and the immunoglobulin heavy-chain muE1 site
RL Proc. Natl. Acad. Sci. USA 88:9804-9808 (1991).
RN [8]; RE0003083.
RX PUBMED: 1309593.
RA Flanagan J. R., Becker K. G., Ennist D. L., Gleason S. L., Driggers P. H., Levi B.-Z., Appella E., Ozato K.
RT Cloning of a negative transcription factor that binds to the upstream conserved region of Moloney murine leukemia virus
RL Mol. Cell. Biol. 12:38-44 (1992).
RN [9]; RE0006424.
RX PUBMED: 8917507.
RA Yang W. M., Inouye C., Zeng Y. Y., Bearss D., Seto E.
RT Transcriptional repression by YY1 is mediated by interaction with a mammalian homolog of yeast global regulator RPD3
RL Proc. Natl. Acad. Sci. USA 93:12845-12850 (1996).
RN [10]; RE0006609.
RX PUBMED: 8413258.
RA Satyamoorthy K., Park K., Atchison M. L., Howe C. C.
RT The intracisternal A-particle upstream element interacts with transcription factor YY1 to activate transcription: pleiotropic effects of YY1 on distinct DNA promoter elements
RL Mol. Cell. Biol. 13:6621-6628 (1993).
RN [11]; RE0008324.
RX PUBMED: 8246966.
RA Riggs K. J., Saleque S., Wong K.K., Merrell K. T., Lee J. S., Shi Y., Calame K.
RT Yin-Yang 1 activates the c-myc promoter
RL Mol. Cell. Biol. 13:7487-7495 (1993).
RN [12]; RE0024024.
RX PUBMED: 12584314.
RA Weill L., Shestakova E., Bonnefoy E.
RT Transcription factor YY1 binds to the murine beta interferon promoter and regulates its transcriptional capacity with a dual activator/repressor role.
RL J. Virol. 77:2903-2914 (2003).
RN [13]; RE0066993.
RX PUBMED: 19843539.
RA Reichman S., Kalathur R. K., Lambard S., Ait-Ali N., Yang Y., Lardenois A., Ripp R., Poch O., Zack D. J., Sahel J. A., Leveillard T.
RT The homeobox gene CHX10/VSX2 regulates RdCVF promoter activity in the inner retina.
RL Hum. Mol. Genet. 19:250-261 (2010).
XX
//