TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T11247 XX ID T11247 XX DT 16.11.2007 (created); djp. DT 01.04.2010 (updated); jig. CO Copyright (C), QIAGEN. XX FA Hesx1 XX SY Hes1; Rathke's pouch homeobox protein; Rathke's pouch homeobox protein; Rpx. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006198 Hesx1. XX CL C0018; paired-homeo. XX SZ 185 AA; 21.6 kDa (cDNA) (calc.). XX SQ MSPSLREGAQLRESKPAPCSFSIESILGLDQKKDCTTSVRPHRPWTDTCGNSEKDGNPPL SQ HAPDLPSETSFPCPVDHPRPEERAPKYENYFSASETRSLKRELSWYRGRRPRTAFTQNQV SQ EVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKMKRSRRESQFLMARKPFN SQ PDLLK XX FT 21 28 conserved octapeptide [3]. FT 106 166 PS50071; HOMEOBOX_2. FT 108 164 PS50552; PAX. FT 108 170 SM00389; HOX_1. FT 109 165 PF00046; Homeobox domain. XX IN T27826 Dnmt1; mouse, Mus musculus. IN T19534 ZNF592; mouse, Mus musculus. XX DR TRANSPATH: MO000117916. DR EMBL: X80040; DR UniProtKB: Q61658; XX RN [1]; RE0011563. RX PUBMED: 7876132. RA Thomas P. Q., Johnson B. V., Rathjen J., Rathjen P. D. RT Sequence, genomic organization, and expression of the novel homeobox gene Hesx1 RL J. Biol. Chem. 270:3869-3875 (1995). RN [2]; RE0013770. RX PUBMED: 9620767. RA Dattani M. T., Martinez-Barbera J.-P., Thomas P. Q., Brickman J. M., Gupta R., Martensson I.-L., Toresson H., Fox M., Wales J. K. H., Hindmarsh P. C., Krauss S., Beddington R. S. P., Robinson I. C. A. F. RT Mutations in the homeobox gene HESX1/Hesx1 associated with septo-optic dysplasia in human and mouse RL Nat. Genet. 19:125-133 (1998). RN [3]; RE0014753. RX PUBMED: 8565852. RA Hermesz E., Mackem S., Mahon K. A. RT Rpx: a novel anterior-restricted homeobox gene progressively activated in the prechordal plate, anterior neural plate and Rathke's pouch of the mouse embryo RL Development 122:41-52 (1996). RN [4]; RE0066383. RX PUBMED: 17931718. RA Sajedi E., Gaston-Massuet C., Andoniadou C. L., Signore M., Hurd P. J., Dattani M., Martinez-Barbera J. P. RT DNMT1 interacts with the developmental transcriptional repressor HESX1. RL Biochim. Biophys. Acta 1783:131-143 (2008). XX //