
AC T14353
XX
ID T14353
XX
DT 23.04.2008 (created); grs.
DT 05.07.2015 (updated); msr.
CO Copyright (C), QIAGEN.
XX
FA HOXC-8
XX
SY D130011F21Rik; homeo box C8; Hox-3.1; Hoxc-8; HOXC8; m31.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G001732 Hoxc8.
XX
CL C0006; homeo.
XX
SZ 242 AA; 27.7 kDa (cDNA) (calc.).
XX
SQ MSSYFVNPLFSKYKGGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFF
SQ HHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANT
SQ NSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRI
SQ EVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEEN
SQ KD
XX
SC Swiss-Prot#P09025
XX
FT 147 207
PS50071; HOMEOBOX_2.
FT 149 211
SM00389; HOX_1.
FT 150 206
PF00046; Homeobox domain.
XX
IN T09446 c-Jun; Mammalia.
IN T09447 JunD; Mammalia.
XX
MX M01321 V$HOXC8_01.
MX M07421 V$HOXC8_Q3.
XX
BS R36217.
BS R36218.
BS R68482.
BS R68484.
BS R68486.
BS R68487.
BS R68490.
BS R68492.
BS R68493.
BS R18934.
BS R18935.
XX
DR TRANSPATH: MO000126500.
DR EMBL: M35603; MMHOXMAA.
DR EMBL: X03659; MMHOX3.
DR EMBL: X07439; MMHOX31R.
DR EMBL: X07646; MMHOX31.
DR UniProtKB: P09025; HXC8_MOUSE.
XX
RN [1]; RE0003885.
RX PUBMED: 7911971.
RA Pellerin I., Schnabel C., Catron K. M., Abate C.
RT Hox proteins have different affinities for a consensus DNA site that correlate with the positions of their genes on the hox cluster
RL Mol. Cell. Biol. 14:4532-4545 (1994).
RN [2]; RE0004000.
RX PUBMED: 1696731.
RA Awgulewitsch A., Bieberich C., Bogarad L., Shashikant C., Ruddle F. H.
RT Structural analysis of the Hox-3.1 transcription unit and the Hox-3.2-Hox-3.1 intergenic region
RL Proc. Natl. Acad. Sci. USA 87:6428-6432 (1990).
RN [3]; RE0004001.
RX PUBMED: 1978325.
RA Bieberich C., Utset M. F., Awgulewitsch A., Ruddle F. H.
RT Evidence for positive and negative regulation of the Hox-3.1 gene
RL Proc. Natl. Acad. Sci. USA 87:8462-8466 (1990).
RN [4]; RE0004002.
RX PUBMED: 1348969.
RA Le Mouellic H., Lallemand Y., Brulet P.
RT Homeosis in the mouse induced by a null mutation in the Hox-3.1 gene
RL Cell 69:251-264 (1992).
RN [5]; RE0004003.
RX PUBMED: 1349171.
RA Violette S. M., Shashikant C. S., Salbaum J. M., Belting H.-G., Wang J. C. H., Ruddle F. H.
RT Repression of the beta-amyloid gene in a Hox-3.1-producing cell line
RL Proc. Natl. Acad. Sci. USA 89:3805-3809 (1992).
RN [6]; RE0004004.
RX PUBMED: 1360875.
RA Pollock R. A., Jay G., Bieberich C. J.
RT Altering the boundaries of Hox3.1 expression: evidence for antipodal gene regulation
RL Cell 71:911-923 (1992).
RN [7]; RE0004005.
RX PUBMED: 8103190.
RA Tomotsune D., Shoji H., Wakamatsu Y., Kondoh H., Takahashi N.
RT A mouse homologue of the Drosophila tumour-suppressor gene l(2)gl controlled by Hox-C8 in vivo
RL Nature 365:69-72 (1993).
RN [8]; RE0004007.
RX PUBMED: 3007994.
RA Awgulewitsch A., Utset M. F., Hart C. P., McGinnis W., Ruddle F. H.
RT Spatial restriction in expression of a mouse homeo box locus within the central nervous system
RL Nature 320:328-335 (1986).
RN [9]; RE0004008.
RX PUBMED: 2900757.
RA Breier G., Dressler G. R., Gruss P.
RT Primary structure and developmental expression pattern of Hox 3.1, a member of the murine Hox 3 homeobox gene cluster
RL EMBO J. 7:1329-1336 (1988).
RN [10]; RE0004009.
RX PUBMED: 2895723.
RA Mouellic H. L., Condamine H., Brulet P.
RT Pattern of transcription of the homeo gene Hox 3.1 in the mouse embryo
RL Genes Dev. 2:125-135 (1988).
RN [11]; RE0004010.
RX PUBMED: 1353983.
RA Peterson R. L., Jacobs D. F., Awgulewitsch A.
RT Hox 3.6: isolation and characterization of a new murine homeobox gene located in the 5' region of the Hox 3 cluster
RL Mech. Dev. 37:151-166 (1992).
RN [12]; RE0006406.
RX PUBMED: 8901587.
RA Shashikant C. S., Ruddle F. H.
RT Combinations of closely situated cis-acting elements determine tissue-specific patterns and anterior extent if early Hoxc8 expression
RL Proc. Natl. Acad. Sci. USA 93:12364-12369 (1996).
RN [13]; RE0006757.
RX PUBMED: 2904354.
RA Gaunt S. J.
RT Mouse homeobox gene transcripts occupy different but overlapping domains in embryonic germ layers and organs: a comparison of Hox-3.1 and Hox-1.5
RL Development 103:135-144 (1988).
RN [14]; RE0014517.
RA Davies J. A., Brandli A. W.
RT The Kidney Development Database; URL: http://www.ana.ed.ac.uk/anatomy/database/kidbase/tranfack.html
RL Internet : (1997).
RN [15]; RE0052694.
RX PUBMED: 11551904.
RA Schaefer L. K., Wang S., Schaefer T. S.
RT Functional interaction of Jun and homeodomain proteins.
RL J. Biol. Chem. 276:43074-43082 (2001).
XX
//