TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T14721 XX ID T14721 XX DT 17.07.2008 (created); tgo. DT 15.01.2010 (updated); pos. CO Copyright (C), QIAGEN. XX FA DSIF-p14 XX SY SPT4; SUPT4H. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G006772 SUPT4H1; HGNC: SUPT4H1. XX SZ 117 AA; 13.2 kDa (cDNA) (calc.). XX SQ MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGI SQ IAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT XX SC Swiss-Prot#P63272 XX FT 11 114 PF06093; Transcription initiation protein Spt4. XX IN T10782 Smad6; Mammalia. XX DR TRANSPATH: MO000130868. DR EMBL: U43923; DR UniProtKB: P63272; XX RN [1]; RE0013618. RX PUBMED: 9450929. RA Wada T., Takagi T., Yamaguchi Y., Ferdous A., Imai T., Hirose S., Sugimoto S., Yano K., Hartzog G. A., Winston F., Buratowski S., Handa H. RT DSIF, a novel transcription elongation factor that regulates RNA polymerase II processivity, is composed of human Spt4 and Spt5 homologs. RL Genes Dev. 12:343-356 (1998). RN [2]; RE0013619. RX PUBMED: 8649394. RA Hartzog G. A., Basrai M. A., Ricupero-Hovasse S. L., Hieter P., Winston F. RT Identification and analysis of a functional human homolog of the SPT4 gene of Saccharomyces cerevisiae. RL Mol. Cell. Biol. 16:2848-2856 (1996). XX //