TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00004 XX ID T00004 XX DT 20.10.1992 (created); ewi. DT 21.01.2016 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Sc XX SY Achaete-Scute T4; AS-C T4; Sc; Scute; Sis-b; Sisterless-b. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX GE G018875 sc. XX CL C0010; bHLH. XX SZ 345 AA; 38.2 kDa (gene) (calc.). XX SQ MKNNNNTTKSTTMSSSVLSTNETFPTTINSATKIFRYQHIMPAPSPLIPGGNQNQPAGTM SQ PIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFA SQ RLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNA SQ VTQLQLCLDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQQQLQRQQFNHQPLTALSL SQ NTNLVGTSVPGGDAGCVSTSKNQQTCHSPTSSFNSSMSFDSGTYEGVPQQISTHLDRLDH SQ LDNELHTHSQLQLKFEPYEHFQLDEEDCTPDDEEILDYISLWQEQ XX SC Swiss-Prot#P10084 XX FT 33 318 PF00478; IMP dehydrogenase / GMP reductase domain. FT 100 163 PS50888; HLH. FT 102 163 PF00010; Helix-loop-helix DNA-binding domain. FT 105 168 SM00353; finulus. XX SF 5th Met codon revealing better match with Kozak rules would give rise of a 274 AA peptide of 30.4 kDa [1]; SF heterodimerization with Da required for efficient DNA-binding [3] [10]; XX CP nervous system - proneural clusters of imaginal disks. CN neurons [4]. XX FF (co-)regulator of neurogenesis, involved in segregation of neural lineages from epidermal precursors [1]; FF expressed in cells delimiting sensory mother cell areas [6]; FF one cell per group with highest Ac and Sc levels becomes a sensory mother cell [6]; FF directing the morphogen Dorsal to target genes in lateral regions of the embryo by cooperative DNA-binding [9]; FF numerator in the sex-determining X:A ratio; FF expression domains are first complementary to those of Ac, then identical due to mutual induction [7] [8]; FF antagonized and down-regulated by Emc [6] [2]; FF repressed by Hairy in a spatially and temporally different pattern [8]; XX IN T01034 Da; fruit fly, Drosophila melanogaster. XX BS R03719. BS R03718. XX DR TRANSPATH: MO000024634. DR EMBL: M17119; DR UniProtKB: P10084; DR FLYBASE: FBgn0004170; sc. XX RN [1]; RE0000187. RX PUBMED: 3111716. RA Villares R., Cabrera C. V. RT The achaete-scute gene complex of D. melanogaster: conserved domains in a subset of genes required for neurogenesis and their homology to myc RL Cell 50:415-424 (1987). RN [2]; RE0000188. RX PUBMED: 1690604. RA Ellis H. M., Spann D. R., Posakony J. W. RT extramacrochaetae, a negative regulator of sensory organ development in Drosophila, defines a new class of helix-loop-helix proteins RL Cell 61:27-38 (1990). RN [3]; RE0000540. RX PUBMED: 1915272. RA Cabrera C. V., Alonso M. C. RT Transcriptional activation by heterodimers of the achaete-scute and daughterless gene products of Drosophila RL EMBO J. 10:2965-2973 (1991). RN [4]; RE0003612. RX PUBMED: 3607875. RA Cabrera C. V., Martinez-Arias A., Bate M. RT The expression of three members of the achaete-scute gene complex correlates with neuroblast segregation in Drosophila RL Cell 50:425-433 (1987). RN [5]; RE0003615. RX PUBMED: 3917860. RA Campuzano S., Carramolino L., Cabrera C. V., Ruiz-Gomez M., Villares R., Boronat A., Modolell J. RT Molecular genetics of the achaete-scute gene complex of D. Melanogaster RL Cell 40:327-338 (1985). RN [6]; RE0003616. RX PUBMED: 2044965. RA Cubas P., de Celis J.-F., Campuzano S., Modolell J. RT Proneural clusters of achaete-scute expression and the generation of sensory organs in the Drosophila imaginal wing disc RL Genes Dev. 5:996-1008 (1991). RN [7]; RE0003617. RX PUBMED: 1900954. RA Martinez C., Modolell J. RT Cross-regulatory interactions between the proneural achaete and scute genes of Drosophila RL Science 251:1485-1487 (1991). RN [8]; RE0003618. RX PUBMED: 2044964. RA Skeath J. B., Carroll S. B. RT Regulation of achaete-scute gene expression and sensory organ pattern formation in the Drosophila wing RL Genes Dev. 5:984-995 (1991). RN [9]; RE0003619. RX PUBMED: 8453668. RA Jiang J., Levine M. RT Binding affinities and cooperative interactions with bHLH activators delimit threshold responses to the dorsal gradient morphogen RL Cell 72:741-752 (1993). RN [10]; RE0003620. RX PUBMED: 7958878. RA Singson A., Leviten M. W., Bang A. G., Hua X. H., Posakony J. W. RT Direct downstream targets of proneural activators in the imaginal disc include genes involved in lateral inhibitory signaling RL Genes Dev. 8:2058-2071 (1994). XX //