TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01034 XX ID T01034 XX DT 20.02.1994 (created); ewi. DT 21.01.2016 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Da XX SY da; Daughterless. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX GE G090465 da. XX CL C0010; bHLH. XX SZ 710 AA; 73.9 kDa (cDNA) (calc.). XX SQ MATSDDEPMHLYEVFQNCFNKIANKQPTGTVGADRGGGGGYHSPYGSLGVENGMYPSDFN SQ SMHDTVNGGNNRYANASTVDQYFDSAAAGSGGAWCQPQMSSANSYMGQSAYQNSGPLSGH SQ SIDQQQQQVHQADGLGMGGGGGGGVGADGMHCPVTTGLPPISSFRPTSGGIGGPGAGQQA SQ PVNVNVNPPAVFNSPQAHNHNHTVQAQHSALSTAGPLGHHSLNHTPHAHSHTLPLPHALP SQ HGHTLPHPHHSQQNSPAVQSSDAFSGAGASVKVAGAGNSSAAALRQQMYMPADQSISSFG SQ SNPSTPVNSPPPLTQSVVGGGGEPSVSGGSGWGHSVLNGGPSSSYASEMVPVSSLHTMAS SQ VFQGVRMEERLDDALNVLRNHCEPEMLAGVNQSLASIDNIDALTSFVPNSPSHLGSGGNS SQ GSVSNTSNAALVHEVLALGAAAAAGTSGQSVGGAGSLASLKLDRSASTSLPKQTKKRKEH SQ TAISNSVPAGVSTTSSLTSLDISDTKPTSSIESSNSGLQQHSQGKGTKRPRRYCSSADED SQ DDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMA SQ VEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGPKLSAQHHMIPQPQQVGGTPGSSYHS SQ QPAQLVPPSSQTISTMTISLPVNQANNGLPPHLQQQQQQQSQLGHAQLPQ XX SC Swiss-Prot#P11420 XX FT 74 523 PF00478; IMP dehydrogenase / GMP reductase domain. FT 553 608 PS50888; HLH. FT 555 608 PF00010; Helix-loop-helix DNA-binding domain. FT 560 613 SM00353; finulus. XX SF a similar putative loop-helix motif as in E2A and E2-2 gene products and HEB was recognized in Da by homology [4]; SF weak biding by Da-homodimers, high-affinity binding by heterodimers with AS-C proteins [3]; XX CP widespread expression. CN maternal germline (oocyte until stage 10, unfertilized eggs) [10]. XX FF activator [3]; FF involved in the formation of the central and peripheral nervous system; FF also acts as a numerator in the sex-determining X:A ratio [9]; FF antagonized by Emc [7]; XX IN T00005 Ac; fruit fly, Drosophila melanogaster. IN T00003 AS-C T3; fruit fly, Drosophila melanogaster. IN T01628 Ato; fruit fly, Drosophila melanogaster. IN T01569 EHAND; mouse, Mus musculus. IN T00004 Sc; fruit fly, Drosophila melanogaster. XX BS R03719. BS R03718. BS R00885. XX DR TRANSPATH: MO000025357. DR EMBL: J03148; DR EMBL: Y00221; DR UniProtKB: P11420; DR FLYBASE: FBgn0000413; da. XX RN [1]; RE0000053. RX PUBMED: 2503252. RA Murre C., McCaw P. S., Vaessin H., Caudy M., Jan L. Y., Jan Y. N., Cabrera C. V., Buskin J. N., Hauschka S. D., Lassar A. B., Weintraub H., Baltimore D. RT Interactions between heterologous helix-loop-helix proteins generate complexes that bind specifically to a common DNA sequence RL Cell 58:537-544 (1989). RN [2]; RE0000092. RX PUBMED: 2493990. RA Murre C., McCaw P. S., Baltimore D. RT A new DNA binding and dimerization motif in immunoglobulin enhancer binding, daughterless, MyoD, and myc proteins RL Cell 56:777-783 (1989). RN [3]; RE0000540. RX PUBMED: 1915272. RA Cabrera C. V., Alonso M. C. RT Transcriptional activation by heterodimers of the achaete-scute and daughterless gene products of Drosophila RL EMBO J. 10:2965-2973 (1991). RN [4]; RE0003543. RX PUBMED: 8423802. RA Quong M. W., Massari M. E., Zwart R., Murre C. RT A new transcriptional-activation motif restricted to a class of helix-loop-helix proteins is functionally conserved in both yeast and mammalian cells RL Mol. Cell. Biol. 13:792-800 (1993). RN [5]; RE0003620. RX PUBMED: 7958878. RA Singson A., Leviten M. W., Bang A. G., Hua X. H., Posakony J. W. RT Direct downstream targets of proneural activators in the imaginal disc include genes involved in lateral inhibitory signaling RL Genes Dev. 8:2058-2071 (1994). RN [6]; RE0003637. RX PUBMED: 8324823. RA Jarman A. P., Grau Y., Jan L. Y., Jan Y. N. RT atonal is a proneural gene that directs chordotonal organ formation in the Drosophila peripheral nervous system RL Cell 73:1307-1321 (1993). RN [7]; RE0003693. RX PUBMED: 1764999. RA van Doren M., Ellis H. M., Posakony J. W. RT The Drosophila extramacrochaetae protein antagonizes sequence-specific DNA binding by daughterless/achaete-scute protein complexes RL Development 113:245-255 (1991). RN [8]; RE0003752. RX PUBMED: 3203380. RA Caudy M., Vaessin H., Brand M., Tuma R., Jan L. Y., Jan Y. N. RT Daughterless, a Drosophila gene essential for both neurogenesis and sex determination, has sequence similarities to myc and the achaete-scute complex. RL Cell 55:1061-1067 (1988). RN [9]; RE0003753. RX PUBMED: 2850968. RA Cronmiller C., Schedl P., Cline T. W. RT Molecular characterisation of daughterless, a Drosophila sex determination gene with multiple roles in development RL Genes Dev. 2:1666-1676 (1988). RN [10]; RE0003754. RX PUBMED: 8217842. RA Cronmiller C., Cummings C. A. RT The daughterless gene product in Drosophila is a nuclear protein that is broadly expressed throughout the organism during development RL Mech. Dev. 42:159-169 (1993). XX //