AC T00005
XX
ID T00005
XX
DT 20.10.1992 (created); ewi.
DT 21.01.2016 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA Ac
XX
SY Ac; Achaete; Achaete-Scute T5; AS-C T5.
XX
OS fruit fly, Drosophila melanogaster
OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae
XX
GE G000089 ac.
XX
CL C0010; bHLH.
XX
SZ 201 AA; 22.8 kDa (gene) (calc.).
XX
SQ MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLS
SQ NGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQKQKQLHLQQQHLHFQQQQQH
SQ QHLYAWHQELQLQSPTGSTSSCNSISSYCKPATSTIPGATPPNNFHTKLEASFEDYRNNS
SQ CSSGTEDEDILDYISLWQDDL
XX
SC Swiss-Prot#P10083
XX
FT 25 91 
PS50888; HLH.
FT 27 91 
PF00010; Helix-loop-helix DNA-binding domain.
FT 30 96 
SM00353; finulus.
XX
CP nervous system - proneural clusters of imaginal disks.
CN neurons [5].
XX
FF (co-)regulator of neurogenesis, probably involved in segregation of neural lineages from epidermal precursor cells [1];
FF involved in sensory mother cell development [7] [12];
FF one cell per group of precursor cells with highest Ac and Sc levels becomes a sensory mother cell [7];
FF expression domains are first complementary to those of Ac, then identical due to mutual induction [8] [9];
FF antagonized and down-regulated by Emc through otherwise stimulatory E-box-like elements in the promoter [7] [10] [2];
FF repressed by Hairy in a spatially and temporally different pattern [4] [9];
XX
IN T01034 Da; fruit fly, Drosophila melanogaster.
IN T01652 HES-5; rat, Rattus norvegicus.
XX
BS R03719.
BS R03718.
XX
DR TRANSPATH: MO000024635.
DR EMBL: M17120;
DR UniProtKB: P10083;
DR FLYBASE: FBgn0000022; ac.
XX
RN [1]; RE0000187.
RX PUBMED: 3111716.
RA Villares R., Cabrera C. V.
RT The achaete-scute gene complex of D. melanogaster: conserved domains in a subset of genes required for neurogenesis and their homology to myc
RL Cell 50:415-424 (1987).
RN [2]; RE0000188.
RX PUBMED: 1690604.
RA Ellis H. M., Spann D. R., Posakony J. W.
RT extramacrochaetae, a negative regulator of sensory organ development in Drosophila, defines a new class of helix-loop-helix proteins
RL Cell 61:27-38 (1990).
RN [3]; RE0000540.
RX PUBMED: 1915272.
RA Cabrera C. V., Alonso M. C.
RT Transcriptional activation by heterodimers of the achaete-scute and daughterless gene products of Drosophila
RL EMBO J. 10:2965-2973 (1991).
RN [4]; RE0002933.
RX PUBMED: 7958929.
RA van Doren M., Bailey A. M., Esnayra J., Ede K., Posakony J. W.
RT Negative regulation of proneural gene activity: hairy is a direct transcriptional repressor of achaete
RL Genes Dev. 8:2729-2742 (1994).
RN [5]; RE0003612.
RX PUBMED: 3607875.
RA Cabrera C. V., Martinez-Arias A., Bate M.
RT The expression of three members of the achaete-scute gene complex correlates with neuroblast segregation in Drosophila
RL Cell 50:425-433 (1987).
RN [6]; RE0003615.
RX PUBMED: 3917860.
RA Campuzano S., Carramolino L., Cabrera C. V., Ruiz-Gomez M., Villares R., Boronat A., Modolell J.
RT Molecular genetics of the achaete-scute gene complex of D. Melanogaster
RL Cell 40:327-338 (1985).
RN [7]; RE0003616.
RX PUBMED: 2044965.
RA Cubas P., de Celis J.-F., Campuzano S., Modolell J.
RT Proneural clusters of achaete-scute expression and the generation of sensory organs in the Drosophila imaginal wing disc
RL Genes Dev. 5:996-1008 (1991).
RN [8]; RE0003617.
RX PUBMED: 1900954.
RA Martinez C., Modolell J.
RT Cross-regulatory interactions between the proneural achaete and scute genes of Drosophila
RL Science 251:1485-1487 (1991).
RN [9]; RE0003618.
RX PUBMED: 2044964.
RA Skeath J. B., Carroll S. B.
RT Regulation of achaete-scute gene expression and sensory organ pattern formation in the Drosophila wing
RL Genes Dev. 5:984-995 (1991).
RN [10]; RE0003619.
RX PUBMED: 8453668.
RA Jiang J., Levine M.
RT Binding affinities and cooperative interactions with bHLH activators delimit threshold responses to the dorsal gradient morphogen
RL Cell 72:741-752 (1993).
RN [11]; RE0003620.
RX PUBMED: 7958878.
RA Singson A., Leviten M. W., Bang A. G., Hua X. H., Posakony J. W.
RT Direct downstream targets of proneural activators in the imaginal disc include genes involved in lateral inhibitory signaling
RL Genes Dev. 8:2058-2071 (1994).
RN [12]; RE0003621.
RX PUBMED: 8458326.
RA Ruiz-Gomez M., Ghysen A.
RT The expression and role of a proneural gene, achaete, in the development of the larval nervous system of Drosophila
RL EMBO J. 12:1121-1130 (1993).
XX
//