AC T00139
XX
ID T00139
XX
DT 26.01.1993 (created); hse.
DT 10.09.2015 (updated); jtr.
CO Copyright (C), QIAGEN.
XX
FA c-Myb
XX
SY c-Myb.
XX
OS chick, Gallus gallus
OC eukaryota; animalia; metazoa; chordata; vertebrata; aves; neornithes; neognathae; galliformes; phasianidae
XX
GE G093308 MYB.
XX
CL C0022; trp.
XX
SZ 641 AA; 72.5 kDa (cDNA) (calc.), 75 kDa (SDS)
XX
SQ MARRPRHSIYSSDDDEEDVEMYDHDYDGLLPKAGKRHLGKTRWTREEDEKLKKLVEQNGT
SQ EDWKVIASFLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
SQ HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
SQ IKNHWNSTMRRKVEQEGYLQESSKAGLPSATTGFQKSSHLMAFAHNPPAGPLPGAGQAPL
SQ GSDYPYYHIAEPQNVPGQIPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
SQ LLMSTENELKGQQALPTQNHTANYPGWHSTTVADNTRTSGDNAPVSCLGEHHHCTPSPPV
SQ DHGCLPEESASPARCMIVHQSNILDNVKNLLEFAETLQLIDSFLNTSSNHENLNLDNPAL
SQ TSTPVCGHKMSVTTPFHRDQPFKTQKENHVFRTPAIKRSILESSPRTPTPFKNALAAQEI
SQ KYGPLKMLPQTPTHLVEDLQDVIKQESEESAIVAGLHESGPPLLKKIKQEVESPTDKAGN
SQ FFCSNHWEGENLNTQLFTHASTMEDVPNLLTSSILKMPVSEEEGSFHKAFAVPRNRPLAS
SQ PMQHLNNAWESASCGKTEDQMALTDQARKYMAAFPTRTLVM
XX
SC Swiss-Prot#P01103
XX
FT 20 546 
PF00478; IMP dehydrogenase / GMP reductase dom.
FT 35 86 
PS50090; MYB_3.
FT 39 88 
SM00717; sant.
FT 40 86 
PF00249; Myb-like DNA-binding domain.
FT 87 138 
PS50090; MYB_3.
FT 91 140 
SM00717; sant.
FT 92 138 
PF00249; Myb-like DNA-binding domain.
FT 139 189 
PS50090; MYB_3.
FT 143 191 
SM00717; sant.
FT 144 189 
PF00249; Myb-like DNA-binding domain.
FT 223 313 PF07988; Mitotic protein Wos2.
FT 275 325 transcription activation domain [2].
FT 350 371 ATBF1-B T00048 interaction domain (v-myb) [20].
XX
SF three imperfect repeats of 51-52 AA, the 2nd and 3rd being essential for specific DNA-binding [1] [10] [5];
SF NMR with repeat 3: three alpha-helices, helix 2 and 3 form a helix-turn-helix structure [16];
SF repeat 2: only helices 1 and 2, helix 3 is disordered, but is alpha-helically folded upon DNA-binding [16];
SF slightly acidic trans-activation domain [2];
SF oncogenic variants are frequently truncated by repeat 1 [10];
SF inhibitory region within the C-terminal part, able to act in cis and trans [12];
SF the leucine zipper has the potential to adopt alpha-helical conformation [19];
XX
CP hematopoietic system, tumor cell lines.
XX
FF DNA-binding is repressed after phosphorylation of Ser-11 and Ser-12 by casein kinase II or related enzymes [10];
FF phosphorylation sites are missing in oncogenic variants [10];
FF possible redox control through Cys-130: oxidation reduces DNA-binding affinity [17];
FF induces Gbx-2 T00139 expression in myeloblasts depending on an activated tyrosine kinase pathway origination at the cell surface [21];
XX
IN T00048 ATBF1-B; human, Homo sapiens.
IN T00139 c-Myb; chick, Gallus gallus.
XX
MX M00004 V$CMYB_01.
MX M01821 V$CMYB_Q5.
MX M00773 V$MYB_Q3.
MX M07299 V$MYB_Q4.
MX M00913 V$MYB_Q5_01.
MX M08890 V$MYB_Q5_02.
MX M00183 V$MYB_Q6.
XX
BS R32837.
BS R69687.
BS R69688.
BS R73993.
BS R02206.
XX
DR TRANSPATH: MO000024727.
DR TRANSCOMPEL: C00240.
DR EMBL: M14129;
DR EMBL: M35509;
DR EMBL: X03477;
DR EMBL: X12495;
DR UniProtKB: P01103;
DR PDB: 1pom.
XX
RN [1]; RE0000112.
RX PUBMED: 2688896.
RA Ness S. A., Marknell A., Graf T.
RT The v-myb oncogene product binds to and activates the promyelocyte-specific mim-1 gene
RL Cell 59:1115-1125 (1989).
RN [2]; RE0000201.
RX PUBMED: 2665942.
RA Weston K., Bishop J. M.
RT Transcriptional Activation by the v-myb oncogene and its cellular progenitor, c-myb
RL Cell 58:85-93 (1989).
RN [3]; RE0000684.
RX PUBMED: 2279697.
RA Luescher B., Eisenman R. N.
RT New light on Myc and Myb. part II. Myb
RL Genes Dev. 4:2235-2241 (1990).
RN [4]; RE0001515.
RX PUBMED: 2072904.
RA Graesser F. A., Graf T., Lipsick J. S.
RT Protein truncation is required for the activation of the c-myb proto-oncogene
RL Mol. Cell. Biol. 11:3987-3996 (1991).
RN [5]; RE0001835.
RX PUBMED: 3185713.
RA Biedenkapp H., Borgmeyer U., Sippel A., Klempnauer K.-H.
RT Viral myb oncogene encodes a sequence-specific DNA-binding activity
RL Nature 335:835-837 (1988).
RN [6]; RE0003549.
RX PUBMED: 3145493.
RA Urbanek P., Dvorak M., Bartunek P., Pecenka V., Paces V., Travnicek M.
RT Nucleotide sequence of chicken myb proto-oncogene promoter region: detection of an evolutionarily conserved element
RL Nucleic Acids Res. 16:11521-11530 (1988).
RN [7]; RE0003550.
RX PUBMED: 2452755.
RA Soret J., Vellard M., Martinerie C., Perbal B.
RT Organization of 5'-proximal c-myb exons in chicken DNA: Implications for c-myb tissue-specific transcription
RL FEBS Lett. 232:227-234 (1988).
RN [8]; RE0003551.
RX PUBMED: 3753748.
RA Rosson D., Reddy P.
RT Nucleotide sequence of chicken c-myb complementary DNA and implications for myb oncogene activation
RL Nature 319:604-606 (1986).
RN [9]; RE0003552.
RX PUBMED: 3025608.
RA Gerondakis S., Bishop J. M.
RT Structure of the protein encoded by the chicken protooncogene c-myb
RL Mol. Cell. Biol. 6:3677-3684 (1986).
RN [10]; RE0003561.
RX PUBMED: 2157164.
RA Luescher B., Christenson E., Lichtfield D. W., Krebs E. G., Eisenman R. N.
RT Myb DNA binding inhibited by phosphorylation at a site deleted during oncogenic activation
RL Nature 344:517-522 (1990).
RN [11]; RE0003564.
RX PUBMED: 3060725.
RA Anton I. A., Frampton J.
RT Tryptophans in myb proteins
RL Nature 336:719-719 (1988).
RN [12]; RE0003565.
RX PUBMED: 1340467.
RA Dubendorff J. W., Whittaker L. J., Eltman J. T., Lipsick J. S.
RT Carboxy-terminal elements of c-myb negatively regulate transcriptional activation in cis and trans
RL Genes Dev. 6:2524-2535 (1992).
RN [13]; RE0003566.
RX PUBMED: 1620600.
RA Weston K.
RT Extension of the DNA binding consensus of the chicken c-myb and v-myb proteins
RL Nucleic Acids Res. 20:3043-3049 (1992).
RN [14]; RE0003568.
RX PUBMED: 2572967.
RA Frampton J., Leutz A., Gibson T., Graf T.
RT DNA-binding domain ancestry
RL Nature 342:134-134 (1989).
RN [15]; RE0003570.
RX PUBMED: 1887237.
RA Gabrielsen O. S., Sentenac A., Fromageot P.
RT Specific DNA-binding by c-myb: evidence for a double helix-turn-helix-related motif
RL Science 253:1140-1143 (1991).
RN [16]; RE0003571.
RX PUBMED: 8365401.
RA Jamin N., Gabrielsen O. S., Gilles N., Toma F.
RT Secondary structure of the DNA-binding domain of the c-myb oncoprotein in solution. A multidimensional double and triple heteronuclear NMR study.
RL Eur. J. Biochem. 216:147-154 (1993).
RN [17]; RE0003572.
RX PUBMED: 8223472.
RA Myrset A. H., Bostad A., Jamin N., Lirsac P.-N., Toma F., Gabrielsen O. S.
RT DNA and redox state induced conformational changes in the DNA-binding domain of the myb oncoprotein.
RL EMBO J. 12:4625-4633 (1993).
RN [18]; RE0003576.
RX PUBMED: 8246954.
RA Dini P. W., Lipsick J. S.
RT Oncogenic truncation of the first repeat of c-myb decreases DNA binding in vitro and in vivo
RL Mol. Cell. Biol. 13:7334-7348 (1993).
RN [19]; RE0003596.
RX PUBMED: 8293811.
RA Ebneth A., Adermann K., Wolfes H.
RT Does a synthetic peptide containing the leucine-zipper domain of c-myb form an alpha-helical structure in solution?
RL FEBS Lett. 337:265-268 (1994).
RN [20]; RE0015127.
RX PUBMED: 10318867.
RA Kaspar P., Dvorakova M., Kralova J., Pajer P., Kozmik Z., Dvorak M.
RT Myb-interacting protein, ATBF1, represses transcriptional activity of Myb oncoprotein
RL J. Biol. Chem. 274:14422-14428 (1999).
RN [21]; RE0015348.
RX PUBMED: 9346236.
RA Kowenz-Leutz E., Herr P., Niss K., Leutz A.
RT The homeobox gene GBX2, a target of the myb oncogene, mediates autocrine growth and monocyte differentiation
RL Cell 91:185-195 (1997).
XX
//