AC T00295
XX
ID T00295
XX
DT 15.10.1992 (created); ewi.
DT 27.01.2016 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA Ftz
XX
SY Ftz; fushi tarazu.
XX
OS fruit fly, Drosophila melanogaster
OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae
XX
GE G000100 ftz.
XX
CL C0006; homeo.
XX
SZ 413 AA; 46.9 kDa (cDNA) (calc.), 60 kDa (SDS)
XX
SQ MATTNSQSHYSYADNMNMYNMYHPHSLPPTYYDNSGSNAYYQNTSNYHSYQGYYPQESYS
SQ ESCYYYNNQEQVTTQTVPPVQPTTPPPKATKRKAEDDAASIIAAVEERPSTLRALLTNPV
SQ KKLKYTPDYFYTTVEQVKKAPAVTTKVTASPAPSYDQEYVTVPTPSASEDVDYLDVYSPQ
SQ SQTQKLKNGDFATPPPTTPTSLPPLEGISTPPQSPGEKSSSAVSQEINHRIVTAPNGAGD
SQ FNWSHIEETLASDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQ
SQ IKIWFQNRRMKSKKDRTLDSSPEHCGAGYTAMLPPLEATSTATTGAPSVPVPMYHHHQTT
SQ AAYPAYSHSHSHGYGLLNDYPQQQTHQQYDAYPQQYQQQCSYQQHPQDLYHLS
XX
SC Swiss-Prot#P02835
XX
FT 1 251 
PF03867; Fushi tarazu (FTZ), N-terminal region.
FT 255 315 
PS50071; HOMEOBOX_2.
FT 257 319 
SM00389; HOX_1.
FT 258 314 
PF00046; Homeobox domain.
XX
SF overlapping DNA-binding specificity with En [19] [1];
SF Ftz(Q50K) mutant exhibits altered, Bcd-like binding specificity [3];
SF isolated DNA-binding domain binds to an optimized binding site as a monomer with KD = 0.25 pM [9];
SF helix-turn-helix structure of the homeo domain confirmed by NMR studies: 3 alpha-helices with 6 AA loop between helix I and II, and a 3 AA turn between helices II and III [16];
SF helix III serves as main DNA-contacting moiety (by homology with Antp) [16];
SF when interacting with Prd, even homeo domain-deleted Ftz can regulate segmentation and gene expression [17];
XX
CP even parasegments [21] [8].
XX
FF activator [5] [15] [19] [20];
FF pair-rule gene product, mutations of which may cause loss of half of larval segments [18];
FF may be bound nearly uniformly throughout the length of its target genes: first binding to a high-affinity site may direct additional Ftz molecules to moderate or low affinity binding sites [13];
FF 3 distinct phases of expression: at 3-4h stage within seven stripes representing the even-numbered parasegments [14] [8];
FF at 8-10h stages within some neuronal precursor cells [21] [8];
FF 12-15h embryos: small ring of Ftz expression appears in a dorsal zone [8];
FF subject to positive autoregulation [23] [10];
FF antagonistic action with En [19];
FF posttranslational modification [8];
XX
IN T00699 Prd; fruit fly, Drosophila melanogaster.
XX
MX M00020 I$FTZ_01.
MX M02343 I$FTZ_02.
MX M07797 I$FTZ_03.
XX
BS R02449.
BS R02450.
BS R02451.
BS R02511.
BS R02512.
BS R02513.
BS R02514.
BS R02515.
BS R02516.
BS R02517.
BS R02518.
BS R02519.
BS R02520.
BS R02521.
BS R02522.
BS R02523.
BS R02524.
BS R02525.
BS R02526.
BS R02527.
BS R02528.
BS R02529.
BS R02530.
BS R02531.
BS R02532.
BS R02533.
BS R02534.
BS R02535.
BS R02536.
BS R02537.
BS R02538.
BS R02539.
BS R02540.
BS R02541.
BS R02542.
BS R02543.
BS R02544.
BS R02545.
BS R02546.
BS R02547.
BS R02548.
BS R02549.
BS R02550.
BS R02551.
BS R02552.
BS R02553.
BS R01669.
BS R05416.
BS R05417.
BS R05418.
BS R05419.
BS R05420.
BS R05421.
BS R05422.
BS R05423.
BS R05424.
BS R02510.
BS R17747.
BS R17938.
BS R17939.
BS R17940.
BS R17941.
BS R17942.
BS R17943.
BS R17944.
BS R17945.
BS R17946.
BS R17947.
BS R17948.
BS R17993.
BS R17994.
BS R17996.
BS R17997.
BS R00411.
BS R00412.
BS R17965.
BS R17966.
BS R17967.
BS R17968.
BS R17969.
BS R17970.
BS R17971.
BS R17973.
BS R17974.
BS R17976.
BS R02801.
BS R02351.
BS R02352.
BS R02353.
BS R02354.
BS R02355.
BS R02356.
BS R02357.
BS R02358.
BS R02359.
BS R02360.
BS R02361.
BS R02362.
BS R02363.
BS R02364.
BS R02365.
BS R02366.
BS R02367.
BS R02368.
BS R02369.
BS R02370.
BS R02371.
BS R17422.
BS R17425.
BS R17428.
BS R17343.
BS R17344.
BS R17345.
BS R17346.
BS R17350.
BS R17354.
BS R17358.
BS R17360.
BS R17579.
BS R04537.
BS R03867.
XX
DR TRANSPATH: MO000045950.
DR EMBL: K01947; DMANTC1.
DR EMBL: X00854; DMFTZ1.
DR UniProtKB: P02835; HMFT_DROME.
DR FLYBASE: FBgn0001077.
DR PDB: 1ftz.
XX
RN [1]; RE0000063.
RX PUBMED: 3046753.
RA Desplan C., Theis J., O'Farrell P. H.
RT The sequence specificity of homeodomain-DNA interaction
RL Cell 54:1081-1090 (1988).
RN [2]; RE0000066.
RX PUBMED: 2572327.
RA Treisman J., Goenczy P., Vashishta M., Harris E., Desplan C.
RT A single amino acid can determine the DNA binding specificity of homeodomain proteins
RL Cell 59:553-562 (1989).
RN [3]; RE0000485.
RX PUBMED: 1979032.
RA Percival-Smith A., Mueller M., Affolter M., Gehring W. J.
RT The interaction with DNA of wild-type and mutant fushi tarazu homeodomains
RL EMBO J. 9:3967-3974 (1990).
RN [4]; RE0000602.
RX PUBMED: 2113881.
RA Ueda H., Sonoda S., Brown J. L., Scott M. P., Wu C.
RT A sequence-specific DNA-binding protein that activates fushi tarazu segmentation gene expression
RL Genes Dev. 4:624-635 (1990).
RN [5]; RE0002736.
RX PUBMED: 1970761.
RA Ohkuma Y., Horikoshi M., Roeder R. G., Desplan C.
RT Binding site-dependent direct activation and repression of in vitro transcription by Drosophila homeodomain proteins
RL Cell 61:475-484 (1990).
RN [6]; RE0002799.
RX PUBMED: 1851122.
RA Topol J., Dearolf C. R., Prakash K., Parker C. S.
RT Synthetic oligonucleotides recreate Drosophila fushi tarazu zebra-stripe expression
RL Genes Dev. 5:855-867 (1991).
RN [7]; RE0002802.
RX PUBMED: 1679407.
RA Morrissey D., Askew D., Raj L., Weir M.
RT Functional dissection of the paired segmentation gene in Drosophila embryos
RL Genes Dev. 5:1684-1696 (1991).
RN [8]; RE0002804.
RX PUBMED: 3049237.
RA Krause H. M., Klemenz R., Gehring W. J.
RT Expression, modification, and localization of the fushi tarazu protein in Drosophila embryos
RL Genes Dev. 2:1021-1036 (1988).
RN [9]; RE0002815.
RX PUBMED: 1675428.
RA Florence B., Handrow R., Laughon A.
RT DNA-binding specificity of th fushi tarazu homeodomain
RL Mol. Cell. Biol. 11:3613-3623 (1991).
RN [10]; RE0002820.
RX PUBMED: 1574120.
RA Schier A. F., Gehring W. J.
RT Direct homeodomain-DNA interaction in the autoregulation of the fushi tarazu gene
RL Nature 356:804-807 (1992).
RN [11]; RE0004962.
RX PUBMED: 6327065.
RA McGinnis W., Garber R. L., Wirz J., Kuroiwa A., Gehring W. J.
RT A homologous protein-coding sequence in Drosophila homeotic genes and its conservation in other metazoans
RL Cell 37:403-408 (1984).
RN [12]; RE0004963.
RX PUBMED: 6330741.
RA Scott M. P., Weiner A.
RT Structural relationships among genes that control develop-ment: Sequence homology between the Antennapedia, Ultrabithorax, and fushi tarazu loci of Droso-phila
RL Proc. Natl. Acad. Sci. USA 81:4115-4119 (1984).
RN [13]; RE0005061.
RX PUBMED: 7958848.
RA Walter J., Dever C. A., Biggin M. D.
RT Two homeo domain proteins bind with similar specificity to a wide range of DNA sites in Drosophila embryos
RL Genes Dev. 8:1678-1692 (1994).
RN [14]; RE0005086.
RX PUBMED: 2886916.
RA Lawrence P., Johnston P., Macdonald P., Struhl G.
RT Borbders of parasegments in Drosophila are delimited by the fushi tarazu and even-skipped genes
RL Nature 328:440-442 (1987).
RN [15]; RE0005087.
RX PUBMED: 1356761.
RA Mueller J., Bienz M.
RT Sharp anterior boundary of homeotic gene expression conferred by the fushi tarazu protein
RL EMBO J. 11:3653-3661 (1992).
RN [16]; RE0005088.
RX PUBMED: 7909851.
RA Qian Y. Q., Furukubo-Tokunaga K., Resendez-Perez D., Mueller M., Gehring W. J., Wuethrich K.
RT Nuclear magnetic resonance solution structure of the fushi tarazu homeodomain from Drosophila and comparison with the Antennapedia homeodomain
RL J. Mol. Biol. 238:333-345 (1994).
RN [17]; RE0005089.
RX PUBMED: 8538765.
RA Copeland J. W. R., Nasladka A., Dietrich B. H., Krause H. M.
RT Patterning of the Drosophila embryo by a homeodomain-deleted Ftz polypeptide
RL Nature 379:162-165 (1996).
RN [18]; RE0005090.
RX PUBMED: 6330566.
RA Laughon A., Scott M. P.
RT Sequence of a Drosophila segmentation gene: protein structure homology with DNA-binding proteins
RL Nature 310:25-31 (1984).
RN [19]; RE0005091.
RX PUBMED: 2905023.
RA Jaynes J. B., Farrell P. H.
RT Activation and repression of transcription by homoeodomain-containing proteins that bind a common site
RL Nature 336:744-749 (1988).
RN [20]; RE0005092.
RX PUBMED: 2493136.
RA Fitzpatrick V. D., Ingles C. J.
RT The Drosophila fushi tarazu polypeptide is a DNA-binding transcriptional activator in yeast cells
RL Nature 337:666-668 (1989).
RN [21]; RE0005093.
RX PUBMED: 8413588.
RA Zhao J. J., Pick L.
RT Generating loss-of-function phenotypes of the fushi tarazu gene with a targeted ribozyme in Drosophila
RL Nature 365:448-451 (1993).
RN [22]; RE0005094.
RX PUBMED: 8434005.
RA Schier A. F., Gehring W. J.
RT Functional specificity of the homeodomain protein fushi tarazu: The role of DNA-binding specificity in vivo
RL Proc. Natl. Acad. Sci. USA 90:1450-1454 (1993).
RN [23]; RE0005095.
RX PUBMED: 8096173.
RA Schier A. F., Gehring W. J.
RT Analysis of a fushi tarazu autoregulatory element: multiple sequence elements contribute to enhancer activity
RL EMBO J. 12:1111-1119 (1993).
RN [24]; RE0005096.
RX PUBMED: 2743978.
RA Krause H. M., Gehring W. J.
RT Stage-specific phosphorylation of the fushi tarazu protein during Drosophila development
RL EMBO J. 8:1197-1204 (1989).
XX
//