TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00699 XX ID T00699 XX DT 15.10.1992 (created); ewi. DT 08.02.2006 (updated); vma. CO Copyright (C), QIAGEN. XX FA Prd XX SY Paired; Prd. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX GE G021787 prd. XX CL C0018; paired-homeo. XX SZ 613 AA; 65.5 kDa (calc.), 65.5 kDa (DNA) XX SQ MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRLKIVEMAADGI SQ RPCVISRQLRVSHGCVSKILNRYQETGSIRPGVIGGSKPRIATPEIENRIEEYKRSSPGM SQ FSWEIREKLIREGVCDRSTAPSVSAISRLVRGRDAPLDNDMSSASGSPAGDGTKASSSCG SQ SDVSGGHHNNGKPSDEDISDCESEPGIALKRKQRRCRTTFSASQLDELERAFERTQYPDI SQ YTREELAQRTNLTEARIQVWFSNRRARLRKQHTSVSGGAPGGAAASVSHVAASSSLPSVV SQ SSVPSMAPLAMMPGSLDPATVYQQQYDFYGSHANISVSAAAPMASSNLSPGITTTPPHHH SQ QFYNPSANTASYIMPGENGNTTPTGNIIVSSYETQLGSVYGTETETHQTMPRNESPNESV SQ SSAFGQLPPTPNSLSAVVSGAGVTSSSGANSGADPSQSLANASAGSEELSAALKVESVDL SQ IAASQSQLYGGWSSMQALRPNAPLSPEDSLNSTSSTSQALDVTAHQMFHPYQHTPQYASY SQ PAPGHAHSHHGHPHAPHPHAHPHPQYAGAHPHYPPPSSSAHFMPQNFNAAAFPSPSKVNY SQ TTMPPQPFYPSWY XX SC Swiss-Prot#P06601 XX FT 27 151 PF00292; 'Paired box' domain. FT 27 151 SM00351; pax3. FT 27 153 PS51057; PAIRED_2. FT 211 271 PS50071; HOMEOBOX_2. FT 213 269 PS50552; PAX. FT 213 275 SM00389; HOX_1. FT 214 270 PF00046; Homeobox domain. XX SF pair rule gene class [8]; SF Prd(Q->K in position 9 of helix 3): gain of Ftz-like binding specificity [1]; SF distinct binding specificity for paired box and homeodomain [1] [4]; SF paired domain has two subdomains of three alpha-helices each [5]; SF DNA-contacts by helix 3, helices 1 and 2 antiparallel against each other and nearly perpendicular to helix 3 [5]; SF additional minor groove contacts by type II beta turn (39-42) and by the C-terminal tail of the N-terminal subdomain (91-98) [5]; SF no DNA-contacts observed by the similarly structured C-terminal subdomain [5]; SF typical fold of the homeo domain, direct contacts of the recognition helix plus extensive network of water molecules mediating additional major groove contacts of the recognition helix [6]; SF distortions of DNA conformation by the first bound molecule cause cooperative binding of a second one, both contacting each other through their homeo domains [6]; SF Gly-41->Ser mutation (analogous to undulated mutant in mice) abolishes DNA-binding by paired domain [4]; XX CP (embryo 2-4h old:) blastoderm and early gastrula [8]. XX FF regulation of anterior-posterior segmentation [8]; FF activator [3]; FF pair-rule gene product [3]; XX IN T00295 Ftz; fruit fly, Drosophila melanogaster. XX MX M07874 I$PRD_02. MX M01091 I$PRD_Q6. XX BS R01669. BS R02485. BS R02810. BS R02811. BS R00411. BS R02801. BS R02809. BS R17414. BS R17415. BS R17418. BS R17419. BS R17420. BS R17423. BS R17426. BS R17429. BS R17430. BS R02484. XX DR TRANSPATH: MO000045954. DR EMBL: M14548; DMPRD. DR UniProtKB: P06601; HMPR_DROME. DR FLYBASE: FBgn0003145. XX RN [1]; RE0000066. RX PUBMED: 2572327. RA Treisman J., Goenczy P., Vashishta M., Harris E., Desplan C. RT A single amino acid can determine the DNA binding specificity of homeodomain proteins RL Cell 59:553-562 (1989). RN [2]; RE0001777. RX PUBMED: 2895896. RA Hoey T., Levine M. RT Divergent homeo box proteins recognize similar DNA sequences in Drosophila RL Nature 332:858-861 (1988). RN [3]; RE0002802. RX PUBMED: 1679407. RA Morrissey D., Askew D., Raj L., Weir M. RT Functional dissection of the paired segmentation gene in Drosophila embryos RL Genes Dev. 5:1684-1696 (1991). RN [4]; RE0002805. RX PUBMED: 1672661. RA Treisman J., Harris E., Desplan C. RT The paired box encodes a second DNA-binding domain in the Paired homeo domain protein RL Genes Dev. 5:594-604 (1991). RN [5]; RE0004177. RX PUBMED: 7867071. RA Xu W., Rould M. A., Jun S., Desplan C., Pabo C. O. RT Crystal structure of a paired domain-DNA complex at 2.5 A resolution reveals structural basis for Pax developmental mutations RL Cell 80:639-650 (1995). RN [6]; RE0004179. RX PUBMED: 7671301. RA Wilson D. S., Guenther B., Desplan C., Kuriyan J. RT High resolution crystal structure of a paired (Pax) class cooperative homeodomain dimer on DNA RL Cell 82:709-719 (1995). RN [7]; RE0004181. RX PUBMED: 2877746. RA Frigerio G., Burri M., Bopp D., Baumgartner S., Noll M. RT Structure of the segmentation gene paired and the Drosophila PRD gene set as part of a gene network RL Cell 47:735-746 (1986). RN [8]; RE0014029. RA Kilchherr F., Baumgartner S., Bopp D., Frei E., Noll M. RT Isolation of the paired gene of Drosophila and its spatial expression during early embryogenesis RL Nature 321:493-499 (1986). XX //