TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00311 XX ID T00311 XX DT 26.01.1993 (created); hse. DT 20.08.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA GATA-3-isoform1 XX SY GATA-3; GATA-box binding factor 3; GATA3; NF-E1c (chick). XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003927 GATA3; HGNC: GATA3. XX CL C0004; CC; 2.2.1.1.3.1. XX SZ 443 AA; 47.9 kDa (cDNA) (calc.). XX SQ MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV SQ PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT SQ SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE SQ KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL SQ GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL SQ IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG SQ IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT SQ PMHPPSSLSFGPHHPSSMVTAMG XX FT 30 74 essential for trans-activation [7]. FT 249 311 essential for nuclear translocation [7]. FT 257 307 SM00401; ZnF_GATA. FT 257 311 PS50114; GATA_ZN_FINGER_2. FT 263 297 PF00320; GATA zinc finger. FT 303 348 essential for DNA-binding [7]. FT 311 361 SM00401; ZnF_GATA. FT 311 364 PS50114; GATA_ZN_FINGER_2. FT 317 351 PF00320; GATA zinc finger. XX SF 2 zinc finger motifs; XX CP T lymphocytes [3] [12]; neuroblastoma cell lines; eosinophils and basophils [11] [11] [12] [3]. EX blood,neutrophil granulocyte,,adult; none; RT-PCR; total RNA; [11]. XX FF ectopic expression can rescue erythroid differentiation of GATA-1 T00305 deficient murine embryonic stem cells [10]; FF transcription factor, look up the TRANSFAC cross reference for more details; FF a dominant negative mutant of GATA-3-isoform1 (mutation of KRR to AAA at position 304-306) blocks transactivation by GATA-1, -2 and -3 in co-transfection experiments [9]; XX MX M00077 V$GATA3_01. MX M00350 V$GATA3_02. MX M00351 V$GATA3_03. MX M01878 V$GATA3_Q4. MX M00203 V$GATA_C. MX M00789 V$GATA_Q6. XX BS R02158. BS R04901. BS R08143. BS R08144. BS R08145. BS R08146. BS R08147. BS R08148. BS R08265. BS R14554. BS R00590. BS R03268. BS R14574. BS R14575. BS R14576. BS R14538. BS R14541. BS R14542. BS R02795. BS R03723. BS R01432. BS R00507. BS R14566. BS R14572. BS R14573. BS R08270. BS R08271. BS R08272. BS R08276. XX DR TRANSPATH: MO000005568. DR TRANSCOMPEL: C00026. DR TRANSCOMPEL: C00088. DR SMARTDB: SB000096. DR EMBL: M69106; DR EMBL: X55037; DR EMBL: X55122; DR EMBL: X58072; DR UniProtKB: P23771-1; XX RN [1]; RE0000167. RX PUBMED: 2225071. RA Orkin S. H. RT Globin gene regulation and switching: Circa 1990 RL Cell 63:665-672 (1990). RN [2]; RE0000451. RX PUBMED: 1827068. RA Ho I.-C., Vorhees P., Marin N., Oakley B. K., Tsai S.-F., Orkin S. H., Leiden J. M. RT Human GATA-3: a lineage-restricted transcription factor that regulates the expression of the T cell receptor alpha gene RL EMBO J. 10:1187-1192 (1991). RN [3]; RE0000452. RX PUBMED: 2050118. RA Joulin V., Bouries D., Eleouet J.-F., Labastie M.-C., Chretien S., Mattei M.-G., Romeo P.-H. RT A t-cell specific TCR delta DNA binding protein is a member of the human GATA family RL EMBO J. 10:1809-1816 (1991). RN [4]; RE0001473. RX PUBMED: 2017177. RA Ko L. J., Yamamoto M., Leonard M. W., George K. M., Ting P., Engel J. D. RT Murine and human T-lymphocyte GATA-3 factors mediate transcription through a cis-regulatory element within the human T-cell receptor delta gene enhancer RL Mol. Cell. Biol. 11:2778-2784 (1991). RN [5]; RE0002546. RX PUBMED: 1871134. RA Marine J., Winoto A. RT The human enhancer-binding protein Gata3 binds to several T-cell receptor regulatory elemets RL Proc. Natl. Acad. Sci. USA 88:7284-7288 (1991). RN [6]; RE0002959. RX PUBMED: 8321207. RA Merika M., Orkin S. H. RT DNA-binding specificity of GATA family transcription factors RL Mol. Cell. Biol. 13:3999-4010 (1993). RN [7]; RE0007082. RX PUBMED: 8114750. RA Yang Z., Gu L., Romeo P.-H., Bories D., Motohashi H., Yamamoto M., Engel J. D. RT Human GATA-3 trans-activation, DNA-binding, and nuclear localization activities are organized into distinct structural domains RL Mol. Cell. Biol. 14:2201-2212 (1994). RN [8]; RE0011089. RX PUBMED: 7556215. RA Joulin V., Richard-Foy H. RT A new approach to isolate genomic control regions, Application to the GATA transcription factor family RL Eur. J. Biochem. 232:620-626 (1995). RN [9]; RE0011693. RX PUBMED: 7829479. RA Smith V. M., Lee P. P., Szychowski S., Winoto A. RT GATA-3 dominant negative mutant. Functional redundancy of the T cell receptor alpha and beta enhancers. RL J. Biol. Chem. 270:1515-1520 (1995). RN [10]; RE0013446. RX PUBMED: 7823931. RA Blobel G. A., Simon M. C., Orkin S. H. RT Rescue of GATA-1-deficient embryonic stem cells by heterologous GATA-binding proteins. RL Mol. Cell. Biol. 15:626-633 (1995). RN [11]; RE0013448. RX PUBMED: 8507862. RA Zon L. I., Yamaguchi Y., Yee K., Albee E. A., Kimura A., Bennett J. C., Orkin S. H., Ackerman S. J. RT Expression of mRNA for the GATA-binding proteins in human eosinophils and basophils: potential role in gene transcription. RL Blood 81:3234-3241 (1993). RN [12]; RE0013453. RX PUBMED: 8386664. RA Biassoni R., Verdiani S., Cambiaggi A., Romeo P.-H., Ferrini S., Moretta L. RT Human CD3-CD16+ natural killer cells express the hGATA-3 T cell transcription factor and an unrearranged 2.3-kb TcR delta transcript. RL Eur. J. Immunol. 23:1083-1087 (1993). RN [13]; RE0023899. RX PUBMED: 11937547. RA Kieffer L. J., Greally J. M., Landres I., Nag S., Nakajima Y., Kohwi-Shigematsu T., Kavathas P. B. RT Identification of a candidate regulatory region in the human CD8 gene complex by colocalization of DNase I hypersensitive sites and matrix attachment regions which bind SATB1 and GATA-3 RL J. Immunol. 168:3915-3922 (2002). RN [14]; RE0013452. RX PUBMED: 1370462. RA Dorfman D. M., Wilson D. B., Bruns G. A. P., Orkin S. H. RT Human transcription factor GATA-2. Evidence for regulation of preproendothelin-1 gene expression in endothelial cells. RL J. Biol. Chem. 267:1279-1285 (1992). XX //