TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00345 XX ID T00345 XX DT 20.10.1992 (created); ewi. DT 08.02.2006 (updated); vma. CO Copyright (C), QIAGEN. XX FA H XX SY H; Hairy. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX GE G018871 h. XX CL C0010; bHLH. XX SZ 337 AA; 37.0 kDa (cDNA) (calc.). XX SQ MVTGVTAANMTNVLGTAVVPAQLKETPLKSDRRSNKPIMEKRRRARINNCLNELKTLILD SQ ATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSR SQ FPGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAA SQ APYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAV SQ AAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPSSPANSSYE SQ PMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW XX SC Swiss-Prot#P14003 XX FT 32 89 PF00010; Helix-loop-helix DNA-binding domain. FT 32 89 PS50888; HLH. FT 37 94 SM00353; finulus. FT 105 145 PF07527; Hairy Orange. FT 105 145 SM00511; ORANGE. FT 107 136 PS51054; ORANGE. XX SF WRPW peptide is essential for Hairy activity [8]; SF WRPW motif is required for interaction with Groucho protein that mediates maternal influences on neurogenesis, segmentation and sex determination [4]; SF may bind specifically to non-canonical sequences [3]; XX FF transcriptional repressor [2]; FF pair-rule gene product, involved in embryonic segmentation and adult bristle patterning [2] [3] [8] [1]; FF repression of Ac by H is essential for peripheral nervous system development [2]; FF hairy gene is regulated by dorsal and bicoid (maternal effect genes) [6]; FF expressed in 7 regularly spaced stripe along the anterior-posterior egg axis plus 12-15 nuclei in region 0 (95-85% egg length) [6]; XX IN T02451 groucho; fruit fly, Drosophila melanogaster. XX MX M00067 I$HAIRY_01. MX M03145 I$H_01. XX BS R04159. XX DR TRANSPATH: MO000024866. DR EMBL: X15904; DR EMBL: X15905; DR UniProtKB: P14003; DR FLYBASE: FBgn0001168; h. XX RN [1]; RE0000472. RX PUBMED: 2479541. RA Rushlow C. A., Hogan A., Pinchin M. A., Howe K. M., Lardelli M., Ish-Horowicz D. RT The Drosophila hairy protein acts in both segmentation and bristle patterning and shows homology to N-myc RL EMBO J. 8:3095-3103 (1989). RN [2]; RE0002933. RX PUBMED: 7958929. RA van Doren M., Bailey A. M., Esnayra J., Ede K., Posakony J. W. RT Negative regulation of proneural gene activity: hairy is a direct transcriptional repressor of achaete RL Genes Dev. 8:2729-2742 (1994). RN [3]; RE0002934. RX PUBMED: 7958930. RA Ohsako S., Hyer J., Panganiban G., Oliver I., Caudy M. RT hairy function as a DNA-binding helix--loop--helix repressor of Drosophila sensory organ formation RL Genes Dev. 8:2743-2755 (1994). RN [4]; RE0003668. RX PUBMED: 8001118. RA Paroush Z., Finley jr R. L., Kidd T., Wainwright S. M., Ingham P. W., Brent R., Ish-Horowicz D. RT Groucho is required for Drosophila neurogenesis, segmentation, and sex determination and interacts directly with hairy-related bHLH proteins RL Cell 79:805-815 (1994). RN [5]; RE0003669. RX PUBMED: 6776413. RA Nuesslein-Volhard C., Wieschaus E. RT Mutations affecting segment number and polarity in Drosophila RL Nature 287:795-801 (1980). RN [6]; RE0003670. RA Ingham P. W., Howard K. R., Ish-Horowicz D. RT Transcription pattern of the Drosophila segmentation gene hairy RL Nature 318:439-445 (1985). RN [7]; RE0003671. RX PUBMED: 3006986. RA Ish-Horowicz D., Howard K. R., Pinchin S. M., Ingham P. W. RT Molecular and genetic analysis of the hairy locus in Drosophila RL Cold Spring Harb. Symp. Quant. Biol. 50:135-144 (1985). RN [8]; RE0003672. RX PUBMED: 1588951. RA Wainwright S. M., Ish-Horowicz D. RT Point mutations in the Drosophila hairy gene demonstrate in vivo requirements for basic, helix-loop-helix, and WRPW domains RL Mol. Cell. Biol. 12:2475-2483 (1992). XX //