TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00396 XX ID T00396 XX DT 16.12.1992 (created); ewi. DT 04.10.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Pax-7-long XX SY hPax-7; hPax7; HuP1; PAX7. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004662 PAX7; HGNC: PAX7. XX CL C0018; paired-homeo; 3.2.1.1.2.1. XX SZ 520 AA; 56.9 kDa (cDNA) (calc.). XX SQ MAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIV SQ EMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPRQVATPDVEKKIEE SQ YKRENPGMFSWEIRDRLLKDGHCDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDG SQ EKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTH SQ YPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQLAAFNHLLPGGFPPTGMPTL SQ PPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAAAAAADTSSAYGARHSFSS SQ YSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSIS SQ ASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPI SQ PSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT XX SC Swiss-Prot#P23759-1 XX FT 34 161 PF00292; 'Paired box' domain. FT 34 161 SM00351; pax3. FT 34 163 PS51057; PAIRED_2. FT 50 442 PF00478; IMP dehydrogenase / GMP reductase domain. FT 215 275 PS50071; HOMEOBOX_2. FT 217 273 PS50552; PAX. FT 217 279 SM00389; HOX_1. FT 218 274 PF00046; Homeobox domain. FT 342 467 trans-activation domain [2]. XX SF cooperative binding to palindromic TAAT-sites as homodimer or as heterodimer with Pax-3 [2]; SF chromosomal translocation t(1; SF 13)(p36; SF q14) fuses Pax-7-long with FKHR causing a variant of alveolar rhabdomyosarcoma [4]; SF probably protein interaction with hDaxx [5]; XX CP high levels in rhabdomyosarcomas, very low in primary myoblasts [2]. XX FF moderate activator [2]; FF absence of Sonic hedgehog (Shh) blocks expression of (mouse) Pax-3/7 [3]; XX IN T02944 Daxx; human, Homo sapiens. IN T00679 Pax-3; human, Homo sapiens. IN T00396 Pax-7-long; human, Homo sapiens. XX MX M01339 V$PAX7_01. XX DR TRANSPATH: MO000024896. DR EMBL: X15042; DR EMBL: X15250; DR EMBL: X15251; DR EMBL: Z35141; DR UniProtKB: P23759-1; XX RN [1]; RE0002796. RX PUBMED: 2501086. RA Burri M., Tromvoukis Y., Bopp D., Frigerio G., Noll M. RT Conservation of the paired domain in metazoans and its structure in three isolated human genes RL EMBO J. 8:1183-1190 (1989). RN [2]; RE0004252. RX PUBMED: 7527137. RA Schaefer B. W., Czerny T., Bernasconi M., Genni M., Busslinger M. RT Molecular cloning and characterization of a human PAX-7 cDNA expressed in normal and neoplastic myocytes RL Nucleic Acids Res. 22:4574-4582 (1994). RN [3]; RE0006702. RX PUBMED: 8929535. RA Ericson J., Morton S., Kawakami A., Roelink H., Jessell T. M. RT Two critical periods of Sonic Hedgehog signaling required for the specification of motor neuron identity RL Cell 87:661-673 (1996). RN [4]; RE0014051. RX PUBMED: 8187070. RA Davis R. J., D'Cruz C. M., Lovell M. A., Biegel J. A., Barr F. G. RT Fusion of PAX7 to FKHR by the variant t(1;13)(p36;q14) translocation in alveolar rhabdomyosarcoma RL Cancer Res. 54:2869-2872 (1994). RN [5]; RE0014042. RX PUBMED: 10393185. RA Hollenbach A. D., Sublett J. E., McPherson C. J., Grosveld G. RT The Pax3-FKHR oncoprotein is unresponsive to the Pax3-associated repressor hDaxx RL EMBO J. 18:3702-3711 (1999). XX //