AC T00488
XX
ID T00488
XX
DT 15.10.1992 (created); ewi.
DT 29.11.2012 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA Hmra1p
XX
SY a1; MATa1; YCR097W.
XX
OS yeast, Saccharomyces cerevisiae
OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
GE G091146 HMRA1.
XX
CL C0006; homeo; F3.1.1.18.3.
XX
SZ 130 AA; 15.3 kDa (gene) (calc.), 16 kDa (SDS)
XX
SQ MDDICSMAENINRTLFNILGTEIDEINLNTNNLYNFIMESNLTKVEQHTLHKNISNNRLE
SQ IYHHIKKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWVCN
SQ MRIKLKYILY
XX
FT 68 128 
PS50071; HOMEOBOX_2.
FT 70 130 
SM00389; HOX_1.
FT 71 127 
PF00046; Homeobox domain.
XX
SF incomplete splice variant (130 AA, 15.3 kDa) [6] [7] [10];
SF requires heterodimerization with alpha2 for DNA-binding [8] [5];
SF no homodimerization [3];
XX
FF a1/alpha2 heterodimer represses haploid-specific genes [2] [5];
XX
IN T00487 Matalpha2p; yeast, Saccharomyces cerevisiae.
XX
MX M00030 F$MATA1_01.
MX M01679 F$MATA1_02.
XX
BS R03799.
BS R05553.
BS R05554.
BS R05555.
BS R05556.
BS R05557.
BS R05558.
BS R05559.
BS R05560.
BS R05561.
BS R05562.
BS R05563.
BS R05564.
BS R05565.
BS R05566.
BS R04545.
BS R00718.
BS R01019.
BS R02482.
XX
DR EMBL: V01312;
DR EMBL: X59720;
DR UniProtKB: P0CY11;
XX
RN [1]; RE0000064.
RX PUBMED: 2901913.
RA Ko H.-S., Fast P., McBride W., Staudt L. M.
RT A Human Protein Specific for the Immunoglobulin Octamer DNA Motif Contains a Functional Homeobox Domain
RL Cell 55:135-144 (1988).
RN [2]; RE0000104.
RX PUBMED: 3127056.
RA Goutte C., Johnson A. D.
RT a1 Protein Alters the DNA Binding Specificity of alpha2 Repressor
RL Cell 52:875-882 (1988).
RN [3]; RE0000542.
RX PUBMED: 8137824.
RA Ho C.-Y., Adamson J. G., Hodges R. S., Smith M.
RT Heterodimerization of the yeast MATa1 and MATalpha2 proteins is mediated by two leucine zipper-like coiled-coil motifs
RL EMBO J. 13:1403-1413 (1994).
RN [4]; RE0000546.
RX PUBMED: 7907979.
RA Goutte C., Johnson A. D.
RT Recognition of a DNA operator by a dimer composed of two different homeodomain proteins
RL EMBO J. 13:1434-1442 (1994).
RN [5]; RE0002819.
RX PUBMED: 1977088.
RA Dranginis A. M.
RT Binding of yeast a1 and alpha2 as a heterodimer to the operator DNA of a haploid-specific gene
RL Nature 347:682-685 (1990).
RN [6]; RE0005133.
RX PUBMED: 7034964.
RA Astell C. R., Ahlstrom-Jonasson L., Smith M.
RT The sequence of the DNAs coding for the mating-type loci of saccharomyces cerevisiae
RL Cell 27:15-23 (1981).
RN [7]; RE0005134.
RX PUBMED: 6256656.
RA Nasmyth K. A., Tatchell K., Hall B. D., Astell C., Smith M.
RT A position effect in the control of transcription at yeast mating type loci
RL Nature 289:244-250 (1981).
RN [8]; RE0005139.
RX PUBMED: 3887184.
RA Miller A. M., Mackay V. L., Nasmyth K. A.
RT Identification and comparison of two sequence elements that confer cell-type specific transcription in yeast
RL Nature 314:598-603 (1985).
RN [9]; RE0005146.
RX PUBMED: 1574927.
RA Sor F., Cheret G., Fabre F., Faye G., Fukuhara H.
RT Yeast sequencing reports: Sequence of the HMR Region on Chromosome III of Saccharomyces cerevisiae
RL Yeast 8:215-222 (1992).
RN [10]; RE0005147.
RX PUBMED: 6329735.
RA Miller A. M.
RT The yeast MATa1 gene contains two introns
RL EMBO J. 3:1061-1065 (1984).
RN [11]; RE0005148.
RX PUBMED: 6429549.
RA Shepherd J. C. W., McGinnis W., Carrasco A. E., Robertis E. M., Gehring W. J.
RT Fly and frog homeo domains show homologies with yeast mating typre regulatory proteins
RL Nature 310:70-71 (1984).
XX
//