TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00653 XX ID T00653 XX DT 15.10.1992 (created); ewi. DT 26.05.2015 (updated); jtr. CO Copyright (C), QIAGEN. XX FA POU5F1 (Oct-5) XX SY Oct-3; Oct-3/4; Oct-4; Oct-5; OCT3; Oct3/4; Oct4; Otf-3; Otf-4; OTF3; Otf3-rs7; Otf3g; OTF4; POU domain, class 5, transcription factor 1; POU5F1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009191 Pou5f1. XX CL C0007; POU. XX SZ 285 AA; 31.7 kDa (cDNA) (calc.). XX SQ MAYCGPQVGLGLVPQVGVETLQPEGQAGARVESNSEGTSSEPCADRPNAVKLEKVEPTPE SQ ESQDMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSL SQ KNMCKLRPLLEKWVEEADNNENLQEICKSETLVQARKRKRTSIENRVRWSLETMFLKCPK SQ PSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSSIEYSQREEYEATGTPFPGGAVSFPL SQ PPGPHFGTPGYGSPHFTTLYSVPFPEGEAFPSVPVTALGSPMHSN XX SC edited from Swiss-Prot #P20263 according to [4] XX FT 64 138 PF00157; Pou domain - N-terminal to homeobox domain. FT 64 138 SM00352; pou. FT 154 214 PS50071; HOMEOBOX_2. FT 154 216 PS50550; POU_HOMEODOMAIN. FT 156 218 SM00389; HOX_1. FT 157 213 PF00046; Homeobox domain. XX SF arises from the POU5F1 T00651 gene from a downstream translation initiation codon [5] [2] [3] [4]; XX CP (day 7.5, 8.5 embryos); high in cell lines resembling the preimplantation embryo (F9 EC, ES, P19 EC, GCLB cells), morula, blastocyst, inner cell mass, hypoblast; undifferentiated ES cells, testis, ovary, differentiated ES cells [7]. CN granulated metrial gland cell (GMGC) in the placenta [6]; brain, heart, kidney, spleen, muscle, lung, stomach, thymus, liver, skin [7]. XX FF activator during early mouse development [5] [1] [3]; XX MX M03837 V$OCT3_Q6. MX M01125 V$OCT4_01. MX M01124 V$OCT4_02. MX M00795 V$OCT_Q6. XX BS R67955. BS R19366. BS R00864. BS R00870. BS R01885. BS R19260. BS R60511. XX DR TRANSPATH: MO000025083. DR TRANSCOMPEL: C00512. DR TRANSCOMPEL: C00587. XX RN [1]; RE0000059. RX PUBMED: 1967980. RA Okamoto K., Okazawa H., Okuda A., Sakai M., Muramatsu M., Hamada H. RT A novel octamer binding transcription factor is differentially expressed in mouse embryonic cells RL Cell 60:461-472 (1990). RN [2]; RE0000423. RX PUBMED: 2573523. RA Schoeler H. R., Hatzopoulos A. K., Balling R., Suzuki N., Gruss P. RT A family of octamer-specific proteins present during mouse embryogenesis: evidence for germline-specific expression of an Oct factor RL EMBO J. 8:2543-2550 (1989). RN [3]; RE0000424. RX PUBMED: 2573524. RA Schoeler H. R., Balling R., Hatzopoulos A. K., Suzuki N., Gruss P. RT Octamer binding proteins confer transcriptional activity in early mouse embryogenesis RL EMBO J. 8:2551-2557 (1989). RN [4]; RE0001804. RX PUBMED: 1690859. RA Schoeler H. R., Ruppert S., Suzuki N., Chowdhury K., Gruss P. RT New type of POU domain in germ line-specific protein Oct-4 RL Nature 344:435-439 (1990). RN [5]; RE0002740. RX PUBMED: 2357966. RA Schoeler H. R., Dressler G. R., Balling R., Rohdewohld H., Gruss P. RT Oct-4: a germline-specific transcription factor mapping to the mouse t-complex RL EMBO J. 9:2185-2195 (1990). RN [6]; RE0025446. RX PUBMED: 9649510. RA Botquin V., Hess H., Fuhrmann G., Anastassiadis C., Gross M. K., Vriend G., Scholer H. R. RT New POU dimer configuration mediates antagonistic control of an osteopontin preimplantation enhancer by Oct-4 and Sox-2. RL Genes Dev. 12:2073-2090 (1998). RN [7]; RE0036388. RX PUBMED: 12665572. RA Tokuzawa Y., Kaiho E., Maruyama M., Takahashi K., Mitsui K., Maeda M., Niwa H., Yamanaka S. RT Fbx15 is a novel target of Oct3/4 but is dispensable for embryonic stem cell self-renewal and mouse development RL Mol. Cell. Biol. 23:2699-2708 (2003). XX //