AC T00651
XX
ID T00651
XX
DT 15.10.1992 (created); ewi.
DT 11.08.2014 (updated); yre.
CO Copyright (C), QIAGEN.
XX
FA Oct3
XX
SY NF-A3; Oct-3; Oct-3A; Oct-4; Oct-4A; Oct-5; OTF3.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G009191 Pou5f1.
XX
CL C0007; POU.
XX
SZ 352 AA; 38.2 kDa (cDNA) (calc.), 42, 35 kDa (SDS)
XX
SQ MAGHLASDFAFSPPPGGGDGSAGLEPGWVDPRTWLSFQGPPGGPGIGPGSEVLGISPCPP
SQ AYEFCGGMAYCGPQVGLGLVPQVGVETLQPEGQAGARVESNSEGTSSEPCADRPNAVKLE
SQ KVEPTPEESQDMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRF
SQ EALQLSLKNMCKLRPLLEKWVEEADNNENLQEICKSETLVQARKRKRTSIENRVRWSLET
SQ MFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSSIEYSQREEYEATGTPFPG
SQ GAVSFPLPPGPHFGTPGYGSPHFTTLYSVPFPEGEAFPSVPVTALGSPMHSN
XX
SC Swiss-Prot#P20263
XX
FT 131 205 
PF00157; Pou domain - N-terminal to homeobox domain.
FT 131 205 
SM00352; pou.
FT 221 281 
PS50071; HOMEOBOX_2.
FT 221 283 
PS50550; POU_HOMEODOMAIN.
FT 223 285 
SM00389; HOX_1.
FT 224 280 
PF00046; Homeobox domain.
XX
SF exists in a major (42 kDa) and a minor form (35 kDa);
SF usage of a downstream translation initiation codon gives rise to Oct3/Oct-5 T00653 [8] [2] [3] [4];
SF both POUs and POUh domain are required for efficient DNA-binding [6];
SF the N-terminal proline-rich region acts as a trans-activating domain [1];
SF dimerization of Oct4 depends on the palindromic motif ATTTG-CAAAT, which has to be spaced by five nucleotides (PORE element) [24];
XX
CP day 7.5, 8.5 embryos, brain (12d embryos); PGC, undifferentiated embryonic cells [8] [2]; morulae, inner cell mass (ICM) of blastocysts, epiblast of day 5,5 and 6,5 embryo [24] [8] [24] [2].
XX
FF activator in early mouse development [8] [1] [3];
FF requires an additional factor, present in embryonal stem cells, to activate from remote enhancer elements [17];
FF may induce differentiation and is down-regulated during differentiation [1] [12];
FF also down-regulated by differentiation-inducing retinoic acid, accompanied by enhanced methylation and altered chromatin structure of the oct4 gene [1] [11] [15];
FF synergistically cooperates with Sox-2 [10];
FF comparing different Oct factors show that Oct4 is the most potent transactivator in this particular context [23];
FF the ability of Oct4 to efficiently activate transcription via the MOREs R16335 and POREs may be due to the presence of E1A protein in 293 cells, a transcriptional coactivator that can enhance Oct4 monomeric activity but not that of Oct1 or Oct2 [23];
FF Sox2 T01836 interferes with Oct4 mediated transcriptional activation [24];
XX
IN T08450 DAX1; mouse, Mus musculus.
IN T19229 DRRS; mouse, Mus musculus.
IN T18507 nanog; Mammalia.
IN T00651 Oct3; mouse, Mus musculus.
IN T01836 Sox-2; mouse, Mus musculus.
XX
MX M03837 V$OCT3_Q6.
MX M01125 V$OCT4_01.
MX M01124 V$OCT4_02.
MX M00795 V$OCT_Q6.
XX
BS R16335.
BS R16336.
BS R16337.
BS R16338.
BS R16339.
BS R16358.
BS R16359.
BS R16360.
BS R16363.
BS R16364.
BS R16340.
BS R16341.
BS R02824.
BS R00303.
BS R00304.
BS R00305.
BS R00306.
BS R15140.
BS R00864.
BS R01884.
BS R01885.
BS R01886.
BS R25730.
BS R16819.
BS R16820.
BS R33113.
BS R16334.
BS R17098.
BS R57679.
BS R57680.
BS R16355.
BS R16357.
BS R02227.
XX
DR TRANSPATH: MO000042436.
DR TRANSCOMPEL: C00454.
DR TRANSCOMPEL: C00587.
DR EMBL: X52437;
DR UniProtKB: P20263;
DR PDB: 1ocp.
XX
RN [1]; RE0000059.
RX PUBMED: 1967980.
RA Okamoto K., Okazawa H., Okuda A., Sakai M., Muramatsu M., Hamada H.
RT A novel octamer binding transcription factor is differentially expressed in mouse embryonic cells
RL Cell 60:461-472 (1990).
RN [2]; RE0000423.
RX PUBMED: 2573523.
RA Schoeler H. R., Hatzopoulos A. K., Balling R., Suzuki N., Gruss P.
RT A family of octamer-specific proteins present during mouse embryogenesis: evidence for germline-specific expression of an Oct factor
RL EMBO J. 8:2543-2550 (1989).
RN [3]; RE0000424.
RX PUBMED: 2573524.
RA Schoeler H. R., Balling R., Hatzopoulos A. K., Suzuki N., Gruss P.
RT Octamer binding proteins confer transcriptional activity in early mouse embryogenesis
RL EMBO J. 8:2551-2557 (1989).
RN [4]; RE0001804.
RX PUBMED: 1690859.
RA Schoeler H. R., Ruppert S., Suzuki N., Chowdhury K., Gruss P.
RT New type of POU domain in germ line-specific protein Oct-4
RL Nature 344:435-439 (1990).
RN [5]; RE0002096.
RX PUBMED: 1979677.
RA Meijer D., Graus A., Kraay R., Langeveld A., Mulder M. P., Grosveld G.
RT The octamer binding factor Oct6: cDNA cloning and expression in early embryonic cells
RL Nucleic Acids Res. 18:7357-7365 (1990).
RN [6]; RE0002176.
RX PUBMED: 1886774.
RA Imagawa M., Miyamoto A., Shirakawa M., Hamada H., Muramatsu M.
RT Stringent integrity requirements for both trans-activation and DNA-binding in a trans-activator, Oct3
RL Nucleic Acids Res. 19:4503-4508 (1991).
RN [7]; RE0002611.
RX PUBMED: 2536195.
RA Lenardo M.-J., Staudt L., Robbins P., Kuang A., Mulligan R. C., Baltimore D.
RT Repression of the IgH enhancer in teratocarcinoma cells associated with a novel octamer factor
RL Science 243:544-546 (1989).
RN [8]; RE0002740.
RX PUBMED: 2357966.
RA Schoeler H. R., Dressler G. R., Balling R., Rohdewohld H., Gruss P.
RT Oct-4: a germline-specific transcription factor mapping to the mouse t-complex
RL EMBO J. 9:2185-2195 (1990).
RN [9]; RE0004235.
RX PUBMED: 1673230.
RA Treacy M. N., He X., Rosenfeld M. G.
RT I-POU: a POU-domain protein that inhibits neuron-specific gene activation
RL Nature 350:577-584 (1991).
RN [10]; RE0004339.
RX PUBMED: 7590241.
RA Yuan H., Corbi N., Basilico C., Dailey L.
RT Developmental-specific activity of the FGF-4 enhancer requires the synergistic action of Sox2 and Oct-3
RL Genes Dev. 9:2635-2345 (1995).
RN [11]; RE0004387.
RX PUBMED: 7678695.
RA Ben-Shushan E., Pikarsky E., Klar A., Bergman Y.
RT Extinction of Oct-3/4 gene expression in embryonal carcinoma X fibroblast somatic cell hybrids is accompanied by changes in the methylation status, chromatin structure and transcriptional activity of the Oct-3/4 upstream region
RL Mol. Cell. Biol. 13:891-901 (1993).
RN [12]; RE0004388.
RX PUBMED: 8223459.
RA Shimazaki T., Okazawa H., Fujii H., Ikeda M., Tamai K., McKay R. D. G., Muramatsu M., Hamada H.
RT Hybrid cell extinction and re-expression of Oct-3 function correlates with differentiation potential
RL EMBO J. 12:4489-4498 (1993).
RN [13]; RE0004389.
RX PUBMED: 8289793.
RA Schoorlemmer J., van Puijenbroek A., van den Eijnden M., Jonk L., Pals C., Kruijer W.
RT Characterization of a negative retinoic acid response element in the murine Oct4 promoter
RL Mol. Cell. Biol. 14:1122-1136 (1994).
RN [14]; RE0004390.
RX PUBMED: 8289783.
RA Pikarsky E., Sharir H., Cen-Shushan E., Bergman Y.
RT Retinoic acid represses Oct-3/4 gene expression through several retinoic acid-responsive elements located in the promoter-enhancer region
RL Mol. Cell. Biol. 14:1026-1038 (1994).
RN [15]; RE0004392.
RX PUBMED: 1972777.
RA Rosner M. H., Vigano M. A., Ozato K., Timmons P. M., Poirier F., Rigby P. W. J., Staudt L. M.
RT A POU-domain transcription factor in early stem cells and germ cells of the mammalian embryo
RL Nature 345:686-692 (1990).
RN [16]; RE0004393.
RX PUBMED: 1915274.
RA Okazawa H., Okamoto K., Ishino F., Ishino-Kaneko T., Takeda S., Toyoda Y., Muramatsu M., Hamada H.
RT The oct3 gene, a gene for an embryonic transcription factor, is controlled by a retinoic acid repressible enhancer
RL EMBO J. 10:2997-3005 (1991).
RN [17]; RE0004394.
RX PUBMED: 1830243.
RA Schoeler H. R., Ciesiolka T., Gruss P.
RT A nexus between Oct-4 and E1A: implications for gene regulation in embryonic stem cells
RL Cell 66:291-304 (1991).
RN [18]; RE0004395.
RX PUBMED: 1732736.
RA Hinkley C. S., Martin J. F., Leibham D., Perry M.
RT Sequential expression of multiple PPU proteins during amphibian early development
RL Mol. Cell. Biol. 12:638-649 (1992).
RN [19]; RE0004396.
RX PUBMED: 1991317.
RA Ruvkun G., Finney M.
RT Regulation of transcription and cell identiy by POU domain proteins
RL Cell 64:475-478 (1991).
RN [20]; RE0004397.
RX PUBMED: 2044958.
RA Rosenfeld M. G.
RT POU-domain transcription factors: pou-er-ful developmental regulators
RL Genes Dev. 5:897-907 (1991).
RN [21]; RE0004398.
RX PUBMED: 1676977.
RA Siracusa L. D., Rosner M. H., Vigano M. A., Gilbert D. J., Staudt L. M., Copeland N. G., Jenkins N. A.
RT Chromosomal location of the octamer transcription factors, Otf-1, Otf-2, and Otf-3, defines multiple Otf-3-related sequences dispersed in the mouse genome
RL Genomics 10:313-326 (1991).
RN [22]; RE0004400.
RX PUBMED: 8097478.
RA Morita E. H., Shirakawa M., Hayashi F., Imagawa M., Kyogoku Y.
RT Secondary structure of the oct-3 POU homeodomain as determined by 1H-15N NMR spectroscopy
RL FEBS Lett. 321:107-110 (1993).
RN [23]; RE0025445.
RX PUBMED: 11136971.
RA Tomilin A., Remenyi A., Lins K., Bak H., Leidel S., Vriend G., Wilmanns M., Scholer H. R.
RT Synergism with the coactivator OBF-1 (OCA-B, BOB-1) is mediated by a specific POU dimer configuration.
RL Cell 103:853-864 (2000).
RN [24]; RE0025446.
RX PUBMED: 9649510.
RA Botquin V., Hess H., Fuhrmann G., Anastassiadis C., Gross M. K., Vriend G., Scholer H. R.
RT New POU dimer configuration mediates antagonistic control of an osteopontin preimplantation enhancer by Oct-4 and Sox-2.
RL Genes Dev. 12:2073-2090 (1998).
RN [25]; RE0047531.
RX PUBMED: 16518401.
RA Loh Y. H., Wu Q., Chew J. L., Vega V. B., Zhang W., Chen X., Bourque G., George J., Leong B., Liu J., Wong K. Y., Sung K. W., Lee C. W., Zhao X. D., Chiu K. P., Lipovich L., Kuznetsov V. A., Robson P., Stanton L. W., Wei C. L., Ruan Y., Lim B., Ng H. H.
RT The Oct4 and Nanog transcription network regulates pluripotency in mouse embryonic stem cells.
RL Nat. Genet. 38:431-440 (2006).
RN [26]; RE0068357.
RX PUBMED: 19528230.
RA Sun C., Nakatake Y., Akagi T., Ura H., Matsuda T., Nishiyama A., Koide H., Ko M. S., Niwa H., Yokota T.
RT Dax1 binds to Oct3/4 and inhibits its transcriptional activity in embryonic stem cells.
RL Mol. Cell. Biol. 29:4574-4583 (2009).
RN [27]; RE0068443.
RX PUBMED: 19403798.
RA Lang K. C., Lin I. H., Teng H. F., Huang Y. C., Li C. L., Tang K. T., Chen S. L.
RT Simultaneous overexpression of Oct4 and Nanog abrogates terminal myogenesis.
RL Am. J. Physiol. Cell Physiol. 297:C43-54 (2009).
RN [28]; RE0071316.
RX PUBMED: 17496161.
RA Zhang Z., Liao B., Xu M., Jin Y.
RT Post-translational modification of POU domain transcription factor Oct-4 by SUMO-1.
RL FASEB J. 21:3042-3051 (2007).
XX
//