AC T00863
XX
ID T00863
XX
DT 15.10.1992 (created); ewi.
DT 27.01.2016 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA Ubx
XX
SY Ubx; ultrabithorax.
XX
OS fruit fly, Drosophila melanogaster
OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae
XX
GE G000124 Ubx.
XX
CL C0006; homeo.
XX
SZ 389 AA; 40.0 kDa (gene) (calc.).
XX
SQ MNSYFEQASGFYGHPHQATGMAMGSGGHHDQTASAAAAAYRGFPLSLGMSPYANHHLQRT
SQ TQDSPYDASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGGGGGGGGGG
SQ GGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRG
SQ GSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFY
SQ PWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQ
SQ TYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKEL
SQ NEQEKQAQAQKAAAAAAAAAAVQGGHLDQ
XX
SC Swiss-Prot#P83949
XX
FT 36 386 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 293 353 
PS50071; HOMEOBOX_2.
FT 295 357 
SM00389; HOX_1.
FT 296 352 
PF00046; Homeobox domain.
XX
SF several splice variants, differing in sequences encoded by some microexons [14] [20];
SF binds to DNA through the homeo domain [16];
SF cooperation with other factors is required for repression [16];
SF cooperative binding to DNA with Exd [9] [13];
SF essential for Exd interaction are residues 23, 25, 57, which also discriminate between Ubx and Antp functions, and the C-terminus [11] [13];
SF discriminator residues over Dfd and Abd-B are at the N-terminus of the homeo domain [7] [8] [2];
SF KD = 0.7 pM for binding to an optimal DNA sequence (TTAATGG, with the central TAAT being of particular importance) [5];
XX
FF activator and repressor [15] [17] [6];
FF facilitates assembly of transcription initiation complex [12];
FF homeotic selector gene product required for proper development of thoracic structures;
FF positive autoregulation through a cluster of downstream binding sites or through indirect mechanisms as in the visceral mesoderm, probably involving wingless and decapentaplegic gene products [10] [15] [18];
FF a far upstream enhancer activates Ubx expression in parasegments 6, 8, 10, and 12, and represses it in the anterior half of the embryo in a Hb-dependent manner [4];
FF the same enhancer is activated by Tll and Ftz [21] [4];
FF after Ubx induction, its expression pattern is maintained by trithorax group genes in expressing cells and by Polycomb group genes in non-expressing cells [19];
XX
IN T01482 Exd; fruit fly, Drosophila melanogaster.
XX
MX M00018 I$UBX_01.
MX M02376 I$UBX_02.
MX M07834 I$UBX_03.
XX
BS R15505.
BS R02477.
BS R02478.
BS R02479.
BS R02508.
BS R05328.
BS R05329.
BS R05330.
BS R05331.
BS R05332.
BS R05333.
BS R05334.
BS R05335.
BS R05336.
BS R05337.
BS R05338.
BS R05339.
BS R05340.
BS R05341.
BS R05342.
BS R05343.
BS R05344.
BS R05345.
BS R05346.
BS R05347.
BS R05348.
BS R05349.
BS R05350.
BS R05351.
BS R05352.
BS R05353.
BS R05354.
BS R05355.
BS R05356.
BS R05357.
BS R05358.
BS R05359.
BS R05360.
BS R05361.
BS R05362.
BS R05363.
BS R05364.
BS R05365.
BS R05366.
BS R05367.
BS R05368.
BS R05369.
BS R05370.
BS R05371.
BS R05372.
BS R05373.
BS R05374.
BS R05375.
BS R05376.
BS R05377.
BS R05378.
BS R05379.
BS R05380.
BS R05381.
BS R05382.
BS R05383.
BS R05384.
BS R05385.
BS R05386.
BS R05387.
BS R05388.
BS R05389.
BS R05390.
BS R05391.
BS R05392.
BS R05393.
BS R05394.
BS R05395.
BS R05396.
BS R05397.
BS R05398.
BS R05399.
BS R05400.
BS R05401.
BS R05402.
BS R05403.
BS R05404.
BS R05405.
BS R05406.
BS R05407.
BS R05408.
BS R05409.
BS R05410.
BS R05411.
BS R05412.
BS R05413.
BS R05414.
BS R05415.
BS R15506.
BS R17493.
BS R17738.
BS R17740.
BS R17742.
BS R17743.
BS R17746.
BS R17748.
BS R17751.
BS R17752.
BS R17755.
BS R17756.
BS R17759.
BS R17761.
BS R17763.
BS R17764.
BS R17767.
BS R17769.
BS R17770.
BS R17773.
BS R17774.
BS R17777.
BS R17778.
BS R17781.
BS R17782.
BS R17785.
BS R17786.
BS R17789.
BS R17791.
BS R17992.
BS R17995.
BS R17503.
BS R17504.
BS R17914.
BS R17915.
BS R02509.
BS R17459.
BS R17460.
BS R17462.
BS R17463.
BS R17465.
BS R17467.
BS R17469.
BS R17470.
BS R17474.
BS R17476.
BS R17480.
BS R17481.
BS R17483.
BS R17949.
BS R17951.
BS R17953.
BS R17954.
BS R17955.
BS R17331.
BS R17335.
BS R17337.
BS R17341.
BS R01529.
BS R17802.
BS R17803.
BS R02480.
BS R04544.
XX
DR TRANSPATH: MO000045964.
DR EMBL: K01959; DMHOMUBX.
DR EMBL: K01963; DMUBX.
DR EMBL: X05727; DMUBX5.
DR UniProtKB: P83949;
DR FLYBASE: FBgn0003944.
XX
RN [1]; RE0000131.
RX PUBMED: 2897243.
RA Biggin M. D., Tjian R.
RT Transcription factors that activate the Ultrabithorax promoter in developmentally staged extracts
RL Cell 53:699-711 (1988).
RN [2]; RE0000488.
RX PUBMED: 1356765.
RA Ekker S. C., von Kessler D. P., Beachy Ph. A.
RT Differential DNA sequence recognition is a determinant of specificity in homeotic gene action
RL EMBO J. 11:4059-4072 (1992).
RN [3]; RE0000723.
RX PUBMED: 1350559.
RA Lin L., McGinnis W.
RT Mapping functional specificity in the Dfd and Ubx homeo domains
RL Genes Dev. 6:1071-1081 (1992).
RN [4]; RE0002791.
RX PUBMED: 1902784.
RA Qian S., Capovilla M., Pirrotta V.
RT The bx region enhancer, a distant cis-control element of the Drosophila Ubx gene and its regulation by hunchback and other segmentation genes
RL EMBO J. 10:1415-1425 (1991).
RN [5]; RE0002792.
RX PUBMED: 1673656.
RA Ekker S. C., Young K. E., von Kessler D. P., Beachy P. A.
RT Optimal DNA sequence recognition by the Ultrabithorax homeodomain of Drosophila
RL EMBO J. 10:1179-1186 (1991).
RN [6]; RE0002803.
RX PUBMED: 1974540.
RA Johnson F. B., Krasnow M. A.
RT Stimulation of transcription by an Ultrabithorax protein in vitro
RL Genes Dev. 4:1044-1052 (1990).
RN [7]; RE0002965.
RX PUBMED: 7914870.
RA Ekker S. C., Jackson D. G., von Kessler D. P., Sun B. I., Young K. E., Beachy P. A.
RT The degree of variation in DNA sequence recognition among four Drosophila homeotic proteins
RL EMBO J. 13:3551-3560 (1994).
RN [8]; RE0004952.
RX PUBMED: 1358457.
RA Vachon G., Cohen B., Pfeifle C., McGuffin M. E., Botas J., Cohen S. M.
RT Homeotic genes of the Bithorax complex repress limb development in the abdomen of the Drosophila embryo through the target gene Distal-less
RL Cell 71:437-450 (1992).
RN [9]; RE0004954.
RX PUBMED: 7915200.
RA van Dijk M. A., Murre C.
RT extradenticle raises the DNA binding specificity of homeotic selector gene products
RL Cell 78:617-624 (1994).
RN [10]; RE0004956.
RX PUBMED: 7906203.
RA Capovilla M., Brandt M., Botas J.
RT Direct regulation of decapentaplegic by Ultrabithorax and its role in Drosophila midgut morphogenesis
RL Cell 76:461-475 (1994).
RN [11]; RE0004974.
RX PUBMED: 8098307.
RA Chan S.-K., Mann R. S.
RT The segment identity functions of Ultrabithorax are contained within its homeodomain and carboxy-terminal seuqences
RL Genes Dev. 7:796-811 (1993).
RN [12]; RE0005062.
RX PUBMED: 1358759.
RA Johnson F. B., Krasnow M. A.
RT Differential regulation of transcription preinitiation complex assembly by activator and repressor homeo domain protein
RL Genes Dev. 6:2177-2189 (1992).
RN [13]; RE0005071.
RX PUBMED: 7915199.
RA Chan S.-K., Jaffe L., Capovilla M., Botas J., Mann R. S.
RT The DNA binding specificity of Ultrabithorax is modulated by cooperative interactions with Extradenticle, another homeoprotein
RL Cell 78:603-615 (1994).
RN [14]; RE0005208.
RA Weinzierl R., Axton J. M., Ghysen A., Akam M. E.
RT Ultrabithorax mutations in constant and variable regions of the protein coding sequence
RL Genes Dev. 1:386-397 (1987).
RN [15]; RE0005210.
RX PUBMED: 2567632.
RA Krasnow M. A., Saffman E. E., Kornfeld K., Hogness D. S.
RT Transcriptional activation and repression by Ultrabithorax proteins in cultured Drosophila cells
RL Cell 57:1031-1043 (1989).
RN [16]; RE0005211.
RX PUBMED: 2567633.
RA Samson M.-L., Jackson-Grusby L., Brent R.
RT Gene activation and DNA binding by Drosophila Ubx and abd-A proteins
RL Cell 57:1045-1052 (1989).
RN [17]; RE0005212.
RX PUBMED: 1505521.
RA Graba Y., Aragnol D., Laurenti P., Garzino V., Charmot D., Berenger H., Pradel J.
RT Homeotic control in Drosophila: the scabrous gene is an in vivo target of Ultrabithorax proteins
RL EMBO J. 11:3375-3384 (1992).
RN [18]; RE0005213.
RX PUBMED: 8099546.
RA Thueringer F., Cohen S. M., Bienz M.
RT Dissection of an indirect autoregulatory response of a homeotic Drosophila gene
RL EMBO J. 12:2419-2430 (1993).
RN [19]; RE0005214.
RX PUBMED: 7912192.
RA Chan C.-S., Rastelli L., Pirrotta V.
RT A Polycomb response element in the Ubx gene that determines an epigenetically inherited state of expression
RL EMBO J. 13:2553-2564 (1994).
RN [20]; RE0005215.
RX PUBMED: 3938361.
RA Hogness D. S., Lipshitz H. D., Beachy P. A., Peattie D. A., Saint R. B., Goldschmidt-Clermont M., Harte P. J., Gavis E. R., Helfand S. L.
RT Regulation and products of the Ubx domain of the bithorax complex
RL Cold Spring Harb. Symp. Quant. Biol. 50:181-194 (1985).
RN [21]; RE0035450.
RX PUBMED: 8404855.
RA Qian S., Capovilla M., Pirrotta V.
RT Molecular mechanisms of pattern formation by the BRE enhancer of the Ubx gene.
RL EMBO J. 12:3865-3877 (1993).
XX
//