TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01482 XX ID T01482 XX DT 04.05.1995 (created); ewi. DT 27.11.2008 (updated); mka. CO Copyright (C), QIAGEN. XX FA Exd XX SY extradenticle. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX HO Pbx-1 (vertebr.), MATa1 (yeast), ceh-20 (C. elegans). XX CL C0006; homeo. XX SZ 376 AA; 41.7 kDa (cDNA) (calc.). XX SQ MEDPNRMLAHTGGMMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEILQQIMSISEQSLDE SQ AQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGP SQ EKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEF SQ TTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARR SQ KRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI SQ GKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGSGGYDQQQPYD SQ NSMGGYDPNLHQDLSP XX SC Swiss-Prot#P40427 XX FT 33 237 PF03792; PBX domain. FT 236 299 PS50071; HOMEOBOX_2. FT 238 303 SM00389; HOX_1. FT 239 298 PF00046; Homeobox domain. XX SF highly cooperative DNA-binding binds to multiple binding sites and with Ubx T00863 [2] [5]; SF binding with abd-A T01992 and En T00253 [2]; SF binding with HOXB1 T01720 [7]; SF region N-terminal to the homeo domain is required for interaction with Ubx T00863 and abd-A T01992, that with En T00253 requires sequences C-terminally to homeo domain [2]; XX CP visceral mesoderm. XX FF raises DNA-binding specificity of Ubx T00863 and abd-A T01992, but not of Abd-B T01476 or Antp T00026 [2] [5]; FF may be the homeodomain protein that cooperates with Ubx T00863 in dpp activation within parasegment 7, but also represses this gene anterior to this parasegment [1] [6]; XX IN T01992 Abd-A; fruit fly, Drosophila melanogaster. IN T00253 En; fruit fly, Drosophila melanogaster. IN T00863 Ubx; fruit fly, Drosophila melanogaster. XX MX M02340 I$EXD_01. XX BS R15504. BS R15506. BS R17280. BS R17466. BS R17468. BS R17473. BS R17478. BS R17485. BS R09699. BS R09703. BS R15499. XX DR TRANSPATH: MO000045973. DR EMBL: L19295; DMEXDZ. DR EMBL: U33747; DM33747. DR EMBL: Z18864; DMDPBXA. DR UniProtKB: P40427; EXD_DROME. DR FLYBASE: FBgn0000611; exd. XX RN [1]; RE0002968. RX PUBMED: 7859741. RA Sun B., Hursh D. A., Jackson D., Beachy P. A. RT Ultrabithorax protein is necessary but not sufficient for full activation of decapentaplegic expression in the visceral mesoderm RL EMBO J. 14:520-535 (1995). RN [2]; RE0004954. RX PUBMED: 7915200. RA van Dijk M. A., Murre C. RT extradenticle raises the DNA binding specificity of homeotic selector gene products RL Cell 78:617-624 (1994). RN [3]; RE0005069. RX PUBMED: 8104703. RA Rauskolb C., Peifer M., Wieschaus E. RT Extradenticle, a regulator of homeotic gene activity, is a homolog of the homeobox-containing human proto-oncogene pbx1 RL Cell 74:1101-1112 (1993). RN [4]; RE0005070. RX PUBMED: 7846045. RA Johnson F. B., Parker E., Krasnow M. A. RT Extradenticle protein is a selective cofactor for the Drosophila homeotics: Role of the homeodomain and YPWM amino acid motif in the interaction RL Proc. Natl. Acad. Sci. USA 92:739-743 (1995). RN [5]; RE0005071. RX PUBMED: 7915199. RA Chan S.-K., Jaffe L., Capovilla M., Botas J., Mann R. S. RT The DNA binding specificity of Ultrabithorax is modulated by cooperative interactions with Extradenticle, another homeoprotein RL Cell 78:603-615 (1994). RN [6]; RE0005072. RX PUBMED: 7914871. RA Rauskolb C., Wieschaus E. RT Coordinate regulation of downstream genes by extradenticle and the homeotic selector proteins RL EMBO J. 13:3561-3569 (1994). RN [7]; RE0010309. RX PUBMED: 7600572. RA Poepperl H., Bienz M., Studer M., Chan S.-K., Aparicio S., Brenner S., Mann R. S., Krumlauf R. RT Segmental Expression of Hoxb-1 Is Controlled by a Highly Conserved Autoregulatory Loop Dependent upon exd/pbx RL Cell 81:1031-1042 (1995). RN [8]; RE0012313. RX PUBMED: 8643557. RA Chan S.-K., Mann R. S. RT A structural model for a homeotic protein-extradenticle-DNA complex accounts for the choice of Hox protein in the heterodimer RL Proc. Natl. Acad. Sci. USA 93:5223-5228 (1996). XX //