TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00884 XX ID T00884 XX DT 15.10.1992 (created); ewi. DT 19.11.2001 (updated); mas. CO Copyright (C), QIAGEN. XX FA VDR XX SY 1,25-dihydroxyvitamin D3 receptor; NR1I1; VDR; vitamin D receptor. XX OS chick, Gallus gallus OC eukaryota; animalia; metazoa; chordata; vertebrata; aves; neornithes; neognathae; galliformes; phasianidae XX CL C0002; CC (rec). XX SZ 451 AA; 51.3 kDa (calc.), 60.3 kDa (SDS-PAGE) [4] or 67 kDa [5] (SDS-PAGE) [4] [5] XX SQ MSELRGSWDEQQQSMAYLPDADMDTVAASTSLPDPAGDFDRNVPRICGVCGDRATGFHFN SQ AMTCEGCKGFFRRSMKRKAMFTCPFNGDCKITKDNRRHCQACRLKRCVDIGMMKEFILTD SQ EEVQRKREMILKRKEEEALKESLKPKLSEEQQKVIDTLLEAHHKTFDTTYSDFNKFRPPV SQ RSKFSSRMATHSSSVVSQDFSSEDSNDVFGSDAFAAFPEPMEPQMFSNLDLSEESDESPS SQ MNIELPHLPMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEVIMLRSN SQ QSFTMEDMSWTCGSNDFKYKVSDVTQAGHSMDLLEPLVKFQVGLKKLNLHEEEHVLLMAI SQ CILSPDRPGVQDTSLVESIQDRLSDILQTYIRCRHPPPGSRLLYAKMIQKLADLRSLNEE SQ HSKQYRCLSFQPEHSMQLTPLVLEVFGNEIS XX SC translated from EMBL #AF011356 XX FT 44 115 SM00399; c4gold. FT 44 119 PS51030; NUCLEAR_REC_DBD_2. FT 45 120 PF00105; Zinc finger, C4 type (two domains). FT 256 418 SM00430; holi. FT 259 445 PF00104; Ligand-binding domain of nuclear hormon. XX SF usage of two different translational initiation sites generates two different protein forms: first form (451 aa, 60.3 kDa) starting from pos. 1 is translated from suboptimal ATG context, second form (437 aa, 58.6 kDa) starting from pos. 15 (second Methionine) is translated from optimal ATG context [4]; SF phosphorylation; XX CP (adult): strong: kidney [3] [4], intestine [3] [4] [6] especially mucosa [5]; weak: liver [4]; signals in brain might be unspecific [3] [4] and not reproducible [4] [4] [5] [6] [3]. XX FF native ligand is 1,25-dihydroxyvitamin D3 [6]; XX IN T01345 RXR-alpha; human, Homo sapiens. IN T01349 RXR-beta; rat, Rattus norvegicus. IN T01355 TRAP; human, Homo sapiens. XX MX M00966 V$DR3_Q4. MX M00444 V$VDR_Q3. MX M00961 V$VDR_Q6. MX M03569 V$VDR_Q6_01. XX BS R01187. BS R03524. XX DR TRANSPATH: MO000021499. DR EMBL: AF011356; GGAF11356. DR UniProtKB: O42392; XX RN [1]; RE0000117. RX PUBMED: 2159384. RA Schuele R., Umesono K., Mangelsdorf D. J., Bolado J., Pike J. W., Evans R. M. RT Jun-Fos and receptors for vitamins A and D recognize a common response element in the human osteocalcin gene RL Cell 61:497-504 (1990). RN [2]; RE0002373. RX PUBMED: 2835767. RA Baker A. R., McDonnell D. P., Hughes M., Crisp T. M., Mangelsdorf D. J., Haussler M. R., Pike J. W., Shine J., O'Malley B. W. RT Cloning and expression of full-length cDNA encoding human vitamin D receptor RL Proc. Natl. Acad. Sci. USA 85:3294-3298 (1988). RN [3]; RE0002636. RX PUBMED: 3029866. RA McDonnell D. P., Mangelsdorf D. J., Pike J. W., Haussler M. R., O'Malley B. W. RT Molecular cloning of complementary DNA encoding the avian receptor for vitamin D RL Science 235:1214-1217 (1987). RN [4]; RE0016364. RX PUBMED: 9056239. RA Lu Z., Hanson K., DeLuca H. F. RT Cloning and origin of the two forms of chicken vitamin D receptor. RL Arch. Biochem. Biophys. 339:99-106 (1997). RN [5]; RE0016374. RX PUBMED: 6275386. RA Simpson R. U., DeLuca H. F. RT Purification of chicken intestinal receptor for 1 alpha, 25-dihydroxyvitamin D3 to apparent homogeneity RL Proc. Natl. Acad. Sci. USA 79:16-20 (1982). RN [6]; RE0016376. RX PUBMED: 7972109. RA Elaroussi M. A., Prahl J. M., DeLuca H. F. RT The avian vitamin D receptors: primary structures and their origins RL Proc. Natl. Acad. Sci. USA 91:11596-11600 (1994). XX //