TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00923 XX ID T00923 XX DT 15.10.1992 (created); ewi. DT 12.08.2011 (updated); jtr. CO Copyright (C), QIAGEN. XX FA Zta XX SY BZLF1; EB1; Z protein; ZEBRA; Zta. XX OS EBV, Epstein-Barr virus OC viridae; ds-DNA enveloped viruses; herpesviridae; gammaherpesviridae XX CL C0008; bZIP. XX SZ 245 AA; 26.9 kDa (gene) (calc.). XX SQ MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQ SQ LTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPGDNS SQ TVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRY SQ KNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHE SQ DLLNF XX SC Swiss-Prot#P03206 XX FT 170 231 PF00170; bZIP transcription factor. XX SF DNA-binding by a Zta homodimer, bending towards the major groove [7]; XX FF synergizes with R; FF stabilizes TBP-binding through direct interaction; FF also synergizes with c-Myb [6]; FF direct interaction inhibits trans-activation by p53 [8]; XX IN T00671 p53; human, Homo sapiens. IN T00794 TBP; human, Homo sapiens. IN T00923 Zta; EBV, Epstein-Barr virus. XX MX M00711 V$ZTA_Q2. XX BS R03178. BS R03179. BS R03180. BS R03181. BS R04261. BS R00196. BS R03344. BS R03345. BS R36351. BS R00295. BS R00296. BS R00297. BS R00298. BS R00299. BS R00301. BS R00302. BS R36007. BS R26551. BS R26557. XX DR TRANSPATH: MO000002014. DR EMBL: V01555; DR UniProtKB: P03206; XX RN [1]; RE0000326. RX PUBMED: 2540954. RA Farrell P. J., Rowe D. T., Rooney C. M., Kouzarides T. RT Epstein-Barr virus BZLF1 trans-activator specifically binds to a consensus AP-1 site and is related to c-fos RL EMBO J. 8:127-132 (1989). RN [2]; RE0000750. RX PUBMED: 1661258. RA Lieberman P. M., Berk A. J. RT The Zta trans-activator protein stabilizes TFIID association with promoter DNA by direct protein-protein interaction RL Genes Dev. 5:2441-2454 (1991). RN [3]; RE0001170. RX PUBMED: 1649314. RA Taylor N., Flemington E., Kolman J. L., Baumann R. P., Speck S. H., Miller G. RT ZEBRA and a Fos-GCN4 chimeric protein differ in their DNA-binding specificities for sites in the Epstein-Barr virus BZLF1 promoter RL J. Virol. 65:4033-4041 (1991). RN [4]; RE0001175. RX PUBMED: 1851858. RA Young L. S., Lau R., Rowe M., Niedobitek G., Packham G., Shanahan F., Rowe D. T., Greenspan D., Greenspan J. S., Rickinson A. B., Farrell P. J. RT Differentiation-associated expression of the Epstein-Barr BZLF1 transactivator protein in oral hairy leukoplakia RL J. Virol. 65:2868-2874 (1991). RN [5]; RE0002145. RX PUBMED: 1851554. RA Giot F.-F., Mikaelian I., Buisson M., Manet E., Joab I., Nicolas J.-C., Sergeant A. RT Transcriptional interference between the EBV transcription factors EB1 and R: both DNA-binding and activation domains of EB1 are required RL Nucleic Acids Res. 19:1251-1258 (1991). RN [6]; RE0003081. RX PUBMED: 1309587. RA Kenney S. C., Holley-Guthrie E., Quinlivan E. B., Gutsch D., Zhang Q., Bender T., Giot J.-F., Sergeant A. RT The cellular oncogene c-myb can interact synergistically with the Epstein-Barr virus BZLF1 transactivator in lymphoid cells RL Mol. Cell. Biol. 12:136-146 (1992). RN [7]; RE0004643. RX PUBMED: 8355695. RA Kerppola T. K., Curran T. RT Selective DNA bending by a variety of bZIP proteins RL Mol. Cell. Biol. 13:5479-5489 (1993). RN [8]; RE0004644. RX PUBMED: 8114724. RA Zhang Q., Gutsch D., Kenney S. RT Functional and physical interaction between p53 and BZLF1: implications for Epstein-Barr virus latency RL Mol. Cell. Biol. 14:1929-1938 (1994). XX //