TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01076 XX ID T01076 XX DT 24.02.1994 (created); ewi. CO Copyright (C), QIAGEN. XX FA mec-3 XX SY mec-3; mechanosensory protein 3. XX OS Caenorhabditis elegans OC eukaryota; animalia; metazoa; nematoda; secernentea; rhabditia; rhabditida; rhabditina; rhabditoidea; rhabditidae XX GE G001804 mec-3. XX CL C0025; LIM-homeo. XX SZ 321 AA; 37.1 kDa (cDNA) (calc.). XX SQ MEMLESKPLSAISMVIDSIGVDHENQNKCNCCNEQIYDRYIYRMDNRSYHENCVKCTICE SQ SPLAEKCFWKNGRIYCSQHYYKDHSIHRCAGCKKGVSPTDMVYKLKAGLVFHVECHCCSL SQ CGRHLSPGEQILVDDTMMTVSCMSHYPPQMDDNAPGAIGSAVDIPSCSTENPIAPYPIDE SQ SFSSAFQVKKEVDAYGYNFEHYSFSDFCDDDSRMLKRRGPRTTIKQNQLDVLNEMFSNTP SQ KPSKHARAKLALETGLSMRVIQVWFQNRRSKERRLKHLCNYLRHYEQRGLIPPPIHFRNE SQ EMDTTDFNAFCGNFEEEDDED XX SC Swiss-Prot#P09088 XX FT 27 86 PS50023; LIM_DOMAIN_2. FT 28 79 SM00132; lim_4. FT 29 85 PF00412; LIM domain. FT 87 152 PS50023; LIM_DOMAIN_2. FT 88 145 SM00132; lim_4. FT 89 151 PF00412; LIM domain. FT 215 275 PS50071; HOMEOBOX_2. FT 217 293 heterodimerisation region [4]. FT 217 279 SM00389; HOX_1. FT 218 274 PF00046; Homeobox domain. FT 218 274 PS50558; LIM_HOMEODOMAIN. XX SF mec-3 and unc-86 T01882 bind cooperatively as a heterodimer to the mec-3 promoter with an increase of DNA binding affinity and stability [4] [3]; XX CP six touch receptor neurons (AVM, 2x ALM, PVM, 2x PLM) and the FLP and PVD neuron pairs [3]. XX FF cell fate of touch receptor cells once the cells have been generated by unc-86 [4]; XX IN T01882 unc-86; Caenorhabditis elegans. XX BS R08940. BS R08941. BS R08942. BS R08943. XX DR TRANSPATH: MO000025382. DR EMBL: L02877; DR EMBL: M20244; DR UniProtKB: P09088; XX RN [1]; RE0000775. RX PUBMED: 1349545. RA Cohen B., McGuffin E., Pfeifle C., Segal D., Cohen S. M. RT apterous, a gene required for imaginal disc development in Drosophila encodes a member of the LIM family of developmental regulatory proteins RL Genes Dev. 6:715-729 (1992). RN [2]; RE0004774. RX PUBMED: 2898300. RA Way J. C., Chalfie M. RT Mec-3, a homeobox-containing gene that specifies differentiation of the touch receptor neurons in C. elegans RL Cell 54:5-16 (1988). RN [3]; RE0004775. RX PUBMED: 1361171. RA Xue D., Finney M., Ruvkun G., Chalfie M. RT Regulation of the mec-3 gene by the C.elegans homeoproteins UNC-86 and MEC-3 RL EMBO J. 11:4969-4979 (1992). RN [4]; RE0014646. RX PUBMED: 8103239. RA Xue D., Tu Y., Chalfie M. RT Cooperative interactions between the Caenorhabditis elegans homeoproteins UNC-86 and MEC-3 RL Science 261:1324-1328 (1993). XX //