TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01882 XX ID T01882 XX DT 09.08.1996 (created); ewi. DT 03.03.2005 (updated); elf. CO Copyright (C), QIAGEN. XX FA unc-86 XX OS Caenorhabditis elegans OC eukaryota; animalia; metazoa; nematoda; secernentea; rhabditia; rhabditida; rhabditina; rhabditoidea; rhabditidae XX HO POU4F2, POU4F3 (vertebrates). XX CL C0007; POU. XX SZ 467 AA; 52.3 kDa (gene) (calc.). XX SQ MEKAHRFRLPFCSFFPVPLLVSVLIFHHSAPFLIQLFFPSPLFNPLLRPSKISRGSENGA SQ CTSHSTLQRTRKIIQWELPKRGGDQDIGDPRPFRIHLSPPSFKVPLFSTDMQNTAPVPTT SQ TTASKMQPFNNSLFGSFDDPILNARAAQVALADIDVKNVPQLTNPLMRPHDMFSYSNYFS SQ GIHDTSAATNIYQGLPSSSEPFDASVVVPTSSDDQMTPLQQVMAMQQSYGAPPPFQYNMT SQ HPFSTTSIASSNNLARYPIAPPTSDMDTDPRQLETFAEHFKQRRIKLGVTQADVGKALAH SQ LKMPGVGSLSQSTICRFESLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPN SQ TDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQKR SQ DFRSQFRARSAAAVMGPRVMPVLNGNNSNNNLKQGQTTYNGLPGFFD XX SC Swiss-Prot#P13528 XX FT 103 422 PF00478; IMP dehydrogenase / GMP reductase domain. FT 265 342 PF00157; Pou domain - N-terminal to homeobox domain. FT 265 342 SM00352; pou. FT 361 421 PS50071; HOMEOBOX_2. FT 361 423 PS50550; POU_HOMEODOMAIN. FT 363 425 SM00389; HOX_1. FT 364 420 PF00046; Homeobox domain. XX SF unc-86 and mec-3 T01076 bind cooperatively as a heterodimer to the mec-3 promoter with an increase of DNA binding affinity and stability [4] [3]; XX FF required for specifying neural identities of neuroblast lineage daughter cells [1] [2]; FF appears shortly after division of those cells that require this factor for their further development [2]; FF required in touch cell precursors to generate the touch receptor neurons [4]; XX IN T01076 mec-3; Caenorhabditis elegans. XX MX M08057 N$UNC86_01. XX BS R08935. BS R08936. BS R08937. BS R08938. BS R08939. XX DR TRANSPATH: MO000045822. DR EMBL: L10990; CEC30A5. DR EMBL: M22363; CEUNC86A. DR UniProtKB: P13528; UN86_CAEEL. XX RN [1]; RE0000242. RX PUBMED: 2903797. RA Finney M., Ruvkun G., Horvitz H. R. RT The C. elegans cell lineage and differentiation gene unc-86 encodes a protein with a homeodomain and extended similarity to transcription factors RL Cell 55:757-769 (1988). RN [2]; RE0004228. RX PUBMED: 2257628. RA Finney M., Ruvkun G. RT The unc-86 gene product couples cell lineage and cell identity in C. elegans RL Cell 63:895-905 (1990). RN [3]; RE0004775. RX PUBMED: 1361171. RA Xue D., Finney M., Ruvkun G., Chalfie M. RT Regulation of the mec-3 gene by the C.elegans homeoproteins UNC-86 and MEC-3 RL EMBO J. 11:4969-4979 (1992). RN [4]; RE0014646. RX PUBMED: 8103239. RA Xue D., Tu Y., Chalfie M. RT Cooperative interactions between the Caenorhabditis elegans homeoproteins UNC-86 and MEC-3 RL Science 261:1324-1328 (1993). XX //