TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01147 XX ID T01147 XX DT 17.04.1994 (created); ewi. DT 20.08.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA SF-1-isoform3 XX SY Ad4BP; fushi tarazu factor homolog 1; NR5A1; steroidogenic factor 1; STF-1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004502 Nr5a1. XX HO Ftz-F1. XX CL C0002; CC (rec). XX SZ 465 AA; 51.3 kDa (cDNA) (calc.). XX SQ MEMHRIRGSRIGRGRGGEEAALERGGWLSCSAGTWPTNPRTRPGLGTAPCAQTRAIPSQS SQ PSARADPILLPQADAAGMDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN SQ NKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDR SQ ALKQQKKAQIRANGFKLETGPPMGVPPPPPPPPDYMLPPSLHAPEPKALVSGPPSGPLGD SQ IGAPSLPMSVPGPHGPLAGYLYPAFSNRTIKSEYPEPYASPPQQPGPPYSYPEPFSGGPN SQ VPELILQLLQLEPEEDQVRARIVGCLQEPAKSGSDQPAPFSLLCRMADQTFISIVDWARR SQ CMVFKELEVADQMTLLQNCWSELLVLDHIYRQVQYGKEDSILLVSGQEVTELVKPLVLHN SQ PRPLRADSGHPKFQIQGHALARLLCVLGPFEEPQCGMVSGSSYRR XX SC translated from EMBL:D10584 XX FT 87 158 SM00399; c4gold. FT 87 162 PS51030; NUCLEAR_REC_DBD_2. FT 88 163 PF00105; Zinc finger, C4 type (two domains). XX SF pI = 8.67; SF mouse SF-1-isoform3 and ELP transcripts arise from the same structural gene by alternative promoter usage and 3' -splicing [2]; XX CP (Y1, adrenocortical tumor; MA-10, Leydig tumor, alphaT3-1). EX pancreas,beta cell of island of Langerhans,,adult; detectable; immunohistochemistry / immunocytochemistry; protein; [5]. XX FF can bind to FLAT (220-201) and P (85-67) element of promoter of rat insulin-1-gener [5]; FF regulator of insulin expression in beta-cells of the pancreas [5]; FF belongs to small group of orphan nuclear receptors which bind to DNA as monomers [3]; XX IN T04677 DAX1; mouse, Mus musculus. XX MX M03802 V$SF1_Q5. MX M07267 V$SF1_Q5_01. MX M00727 V$SF1_Q6. MX M01132 V$SF1_Q6_01. XX BS R09630. BS R20692. BS R73974. BS R09631. BS R09632. BS R09689. BS R09695. BS R27897. BS R09636. BS R16140. BS R17087. BS R17091. BS R17092. BS R02343. BS R33512. BS R08849. BS R09548. BS R09549. BS R12703. BS R14701. XX DR TRANSPATH: MO000025441. DR TRANSCOMPEL: C00213. DR TRANSCOMPEL: C00214. DR TRANSCOMPEL: C00215. DR TRANSCOMPEL: C00217. DR TRANSCOMPEL: C00218. DR TRANSCOMPEL: C00220. DR TRANSCOMPEL: C00221. DR TRANSCOMPEL: C00222. DR TRANSCOMPEL: C00223. DR EMBL: D10584; DR UniProtKB: P33242; XX RN [1]; RE0000933. RX PUBMED: 2365694. RA Rice D. A., Kirkman M. S., Aitken L. D., Mouw A. R., Schimmer B. P., Parker K. L. RT Analysis of the promoter region of the gene encoding mouse cholesterol side-chain cleavage enzyme RL J. Biol. Chem. 265:11713-11720 (1990). RN [2]; RE0015334. RX PUBMED: 8413309. RA Ikeda Y., Lala D. S., Luo X., Kim E., Moisan M. P., Parker K. L. RT Characterization of the mouse FTZ-F1 gene, which encodes a key regulator of steroid hydroxylase gene expression RL Mol. Endocrinol. 7:852-860 (1993). RN [3]; RE0015434. RX PUBMED: 10913126. RA Ito M., Achermann J. C., Jameson J. L. RT A naturally occurring steroidogenic factor-1 mutation exhibits differential binding and activation of target genes RL J. Biol. Chem. 275:31708-31714 (2000). RN [4]; RE0015482. RX PUBMED: 10446911. RA Tremblay J. J., Viger R. S. RT Transcription factor GATA-4 enhances Mullerian inhibiting substance gene transcription through a direct interaction with the nuclear receptor SF-1 RL Acta Biochim. Pol. 13:1388-1401 (1999). RN [5]; RE0048139. RX PUBMED: 7708065. RA Peers B., Leonard J., Sharma S., Teitelman G., Montminy M. R. RT Insulin expression in pancreatic islet cells relies on cooperative interactions between the helix loop helix factor E47 and the homeobox factor STF-1. RL Mol. Endocrinol. 8:1798-1806 (1994). XX //